(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE257

MICSR_1.PE257        Location/Qualifiers
FT   CDS             join(514161..514658,515308..515494,515855..519729)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636597"
FT                   /orf_name="MICPUN_99395"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO61717.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000199AC3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D4"
FT                   /transl_table=1
FT                   /translation="MFAVTQTASKALLAVPSKASKTRTGRVVVAAAVPHSAVESGKKAM
FT                   LTGILAATFAVGSVDPAQAATVFAGKYIDPNHPHCPREIDADGVISGVDPVPFAKGRGC
FT                   RGYKKKNEAAAVEAGKISLWSIKGVVSKDDATILIDFNQKDGSGESFTGKWNGVGIEFP
FT                   DGNASAPYFSMNAASGSSDVSASISRPFARSSMRCWYRFGGCHGKDGPAAVISLGLRAS
FT                   SKIPMALFGFAGADPKPEPKPEAPPAVANDAPGAVPARGGGAGAIGFSTASGTDRKPRG
FT                   GFRSASLAMAGASKAGVGSSLFTSASSMMVNPDTVDLTADDANEDESPGKRHKTSPEEG
FT                   NEEGKRKETRRYDPVEYREKQRIKREKDERTKKKRQECRQTSIFDAMAGANAPNLRGSA
FT                   DPIPKEVWQRILAHAPVSSLRDMRLVCKTLMNAVDDEGFLPFTKIAQQTRRMRTIDADR
FT                   VIAESAAGRRKPPAVSAAAGGGRVSIGDDRPARDDEDHAAGIIQRIARDKPFATPMSAS
FT                   ALAREVEIGVERAEARDGRTPVPGHVPGEGLAATVRELAGWKIVGSHGWALLAAAILVA
FT                   AEDYGTIALLLDAARRACARADREPDGDLNGGDTAGDNERRHHYTGDYCAREDLTEFIS
FT                   LLAIALTVPSRWTRGAVDAEDVVLREPSASRLAHLDAAAGYLELIPHREAAGDWGADRG
FT                   SFTSRLTHEQLSIVSADVKKDEVLLVRAFAGTGKTTTLLEYVKRRPGYQFAYITFNRSV
FT                   MEEASTKFPKLNVKCLNFHKMAYAKFGFLYRGEKFLRGTLRQYHVSKAIGVNDSRALFA
FT                   IRVLNEFLKSADLAVELKHAEAIRAEVSTKDWNKVYGKSNVKAKLGSQSPEENLVELVK
FT                   NLWDKMLNPEDSSFPMTDAGYLKRYQLACRREHNPVRLDVNFDILMLDEAQDAAPVMAD
FT                   IILSQKECGKILVGDPHQEIYSFMGAKNAMATVAATVDKSKIVERRLTRSFRFGYEIAD
FT                   VANTLLRLKGETTCLIGSRRDLPDPVWSSWSDQEEVSAVHCLPRPKDADGVTLTLQSYA
FT                   PGYAATLRTRLGDRPIREQGRQLVVLCRSNASVFDVASRILNLGIKDLKLGFIGGLEGQ
FT                   RLGQLMDIWRLAVQSDDELDAITDYFVSRFVKEYLKAKENGVKDPEPPLQALKSSAKLS
FT                   NDLEMQTKISIVEKHRGNLPELIEKLKKVDVGTNPSNLKCANYLLSTAHRAKGLEFDHV
FT                   LLWEDFLAVDHCSPVEWDSNGHATLFQIGNMFGDSEIVGADELNLVYVAATRAKQRLIV
FT                   SDALKHLITAPRCNFAATWYLRDRGTNLPLTGMTEVEAAEDWAANEVLAQRRGGPAHFA
FT                   TLRCATNTCDRCGDQSYMFQLPEGSFQADEVDNAPTLGMEVRYGRIRQGMADTDIGMAN
FT                   ADPHAVSTVPMIAPSESYAFRHNRRMCGRCVRTFAVSRRGAERYLDDDTAGAGVERTWV
FT                   DDTILENFVRHSNRVNNIDPIEGMSMMDIASVCAAERRARGEPWRGKDAAGQPRRMAD"
     MFAVTQTASK ALLAVPSKAS KTRTGRVVVA AAVPHSAVES GKKAMLTGIL AATFAVGSVD        60
     PAQAATVFAG KYIDPNHPHC PREIDADGVI SGVDPVPFAK GRGCRGYKKK NEAAAVEAGK       120
     ISLWSIKGVV SKDDATILID FNQKDGSGES FTGKWNGVGI EFPDGNASAP YFSMNAASGS       180
     SDVSASISRP FARSSMRCWY RFGGCHGKDG PAAVISLGLR ASSKIPMALF GFAGADPKPE       240
     PKPEAPPAVA NDAPGAVPAR GGGAGAIGFS TASGTDRKPR GGFRSASLAM AGASKAGVGS       300
     SLFTSASSMM VNPDTVDLTA DDANEDESPG KRHKTSPEEG NEEGKRKETR RYDPVEYREK       360
     QRIKREKDER TKKKRQECRQ TSIFDAMAGA NAPNLRGSAD PIPKEVWQRI LAHAPVSSLR       420
     DMRLVCKTLM NAVDDEGFLP FTKIAQQTRR MRTIDADRVI AESAAGRRKP PAVSAAAGGG       480
     RVSIGDDRPA RDDEDHAAGI IQRIARDKPF ATPMSASALA REVEIGVERA EARDGRTPVP       540
     GHVPGEGLAA TVRELAGWKI VGSHGWALLA AAILVAAEDY GTIALLLDAA RRACARADRE       600
     PDGDLNGGDT AGDNERRHHY TGDYCAREDL TEFISLLAIA LTVPSRWTRG AVDAEDVVLR       660
     EPSASRLAHL DAAAGYLELI PHREAAGDWG ADRGSFTSRL THEQLSIVSA DVKKDEVLLV       720
     RAFAGTGKTT TLLEYVKRRP GYQFAYITFN RSVMEEASTK FPKLNVKCLN FHKMAYAKFG       780
     FLYRGEKFLR GTLRQYHVSK AIGVNDSRAL FAIRVLNEFL KSADLAVELK HAEAIRAEVS       840
     TKDWNKVYGK SNVKAKLGSQ SPEENLVELV KNLWDKMLNP EDSSFPMTDA GYLKRYQLAC       900
     RREHNPVRLD VNFDILMLDE AQDAAPVMAD IILSQKECGK ILVGDPHQEI YSFMGAKNAM       960
     ATVAATVDKS KIVERRLTRS FRFGYEIADV ANTLLRLKGE TTCLIGSRRD LPDPVWSSWS      1020
     DQEEVSAVHC LPRPKDADGV TLTLQSYAPG YAATLRTRLG DRPIREQGRQ LVVLCRSNAS      1080
     VFDVASRILN LGIKDLKLGF IGGLEGQRLG QLMDIWRLAV QSDDELDAIT DYFVSRFVKE      1140
     YLKAKENGVK DPEPPLQALK SSAKLSNDLE MQTKISIVEK HRGNLPELIE KLKKVDVGTN      1200
     PSNLKCANYL LSTAHRAKGL EFDHVLLWED FLAVDHCSPV EWDSNGHATL FQIGNMFGDS      1260
     EIVGADELNL VYVAATRAKQ RLIVSDALKH LITAPRCNFA ATWYLRDRGT NLPLTGMTEV      1320
     EAAEDWAANE VLAQRRGGPA HFATLRCATN TCDRCGDQSY MFQLPEGSFQ ADEVDNAPTL      1380
     GMEVRYGRIR QGMADTDIGM ANADPHAVST VPMIAPSESY AFRHNRRMCG RCVRTFAVSR      1440
     RGAERYLDDD TAGAGVERTW VDDTILENFV RHSNRVNNID PIEGMSMMDI ASVCAAERRA      1500
     RGEPWRGKDA AGQPRRMAD                                                   1519
//

If you have problems or comments...

PBIL Back to PBIL home page