(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE258

MICSR_1.PE258        Location/Qualifiers
FT   CDS             join(520294..520470,520585..521292)
FT                   /codon_start=1
FT                   /gene_family="HOG000264640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636598"
FT                   /orf_name="MICPUN_80015"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO61718.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG560091"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199AC3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D5"
FT                   /transl_table=1
FT                   /translation="MRALEKGEPVSGRVEVANRGGLILRIFNGRFRAFLPLSQMTSSRT
FT                   LDVKRSRKKNAPKSAQVGKVIEVKVTDVNDKKIVVSERALVQERGVKRLKPGVRASAQV
FT                   VSLSDFGAFVELSQDDPQAPRLEGLIHISELSWSRVAHPRDILRVGDEVDVKVLDVAPA
FT                   EGRRPARVTFSLKQLQADPLLETLDTIMPVAMPEPSVDEDELLDTPLPGLMDICSNLLT
FT                   EEGIDAVIPGRQAVEQRVVSQDLELWLTNVVVEDGYNLLARAGRQVQEIHVVTKLSRDS
FT                   IKMAIKRATSALK"
     MRALEKGEPV SGRVEVANRG GLILRIFNGR FRAFLPLSQM TSSRTLDVKR SRKKNAPKSA        60
     QVGKVIEVKV TDVNDKKIVV SERALVQERG VKRLKPGVRA SAQVVSLSDF GAFVELSQDD       120
     PQAPRLEGLI HISELSWSRV AHPRDILRVG DEVDVKVLDV APAEGRRPAR VTFSLKQLQA       180
     DPLLETLDTI MPVAMPEPSV DEDELLDTPL PGLMDICSNL LTEEGIDAVI PGRQAVEQRV       240
     VSQDLELWLT NVVVEDGYNL LARAGRQVQE IHVVTKLSRD SIKMAIKRAT SALK             294
//

If you have problems or comments...

PBIL Back to PBIL home page