(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE259

MICSR_1.PE259        Location/Qualifiers
FT   CDS             complement(521409..522164)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636599"
FT                   /orf_name="MICPUN_56834"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62153.1"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="UniParc:UPI000199AC3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D6"
FT                   /transl_table=1
FT                   /translation="MVAALGGDARAAGAAAPKPEINVAKLTKAEEAIFTLQPGKDAFVK
FT                   LAAALAPFRPVVDHVADALSWRSTRKAMAAQAAFTYAVLYPYVIIPGILLTLGTCTLTN
FT                   RKEDEGSGDEDDGETRSEPAKKKPTPAEPKGASWRSKARKLDARDVQRALENVATRLER
FT                   IIALTTWEDPVVTGAFVAGCLVAALFLASHSFQVVLLCVGLYATRPPSWRVVPGPLESL
FT                   LGRMPDKGEAYARLMQETGNGGKGAASGA"
     MVAALGGDAR AAGAAAPKPE INVAKLTKAE EAIFTLQPGK DAFVKLAAAL APFRPVVDHV        60
     ADALSWRSTR KAMAAQAAFT YAVLYPYVII PGILLTLGTC TLTNRKEDEG SGDEDDGETR       120
     SEPAKKKPTP AEPKGASWRS KARKLDARDV QRALENVATR LERIIALTTW EDPVVTGAFV       180
     AGCLVAALFL ASHSFQVVLL CVGLYATRPP SWRVVPGPLE SLLGRMPDKG EAYARLMQET       240
     GNGGKGAASG A                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page