(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE26

MICSR_1.PE26         Location/Qualifiers
FT   CDS             45722..47734
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636031"
FT                   /orf_name="MICPUN_56598"
FT                   /product="Fused protein"
FT                   /protein_id="ACO61597.1"
FT                   /db_xref="HOGENOM:HBG560093"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199AABC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q3"
FT                   /transl_table=1
FT                   /translation="MVLTVTSLLEVDGCPPIKLREERDNEDVPLRTGCRVWSCARLLAE
FT                   WLANRSGGGEDDGAGPIVVGRDVLELGAGTGAVGLTCAALGASSVTMTDRDEAALALMH
FT                   TNARINGHYDASSTCEVCVQGLDWGDPATYIQGASYDLVVAADVLYLPEHCAALPDAVA
FT                   AHLAPGGEVVVACGLRRAGLLEALVDSLRSVGLDDVCVDLGTLGLDPVDGADARNRAAA
FT                   AVTASEHAHDGAQISAAGGYALVTASVKADWKPPERLSARAVADAKREREEEERNEEER
FT                   NEAERNEADRPRIRGEGNRTPGAVASETAATREEDQLGGEPSEIDSDANSAMGDFLDDF
FT                   EDLGVDAGAPVTRAVPASDDDDEDEVDTLPPYRVHPSPAEVASGAPSASTIAAAADSLA
FT                   RNGFVVLEAEDGAGLVASDVLDSALAASDGYLDRLLAAAKAKGLRVDSDIFRFAELCSR
FT                   AQGGRRFDVTAERRRCGNGGSITLPPRPYPTSDDESAAAAATDAWDGLRRAVDPWVSSA
FT                   LLRSGLMVENDGKGATFGVTAVGCVTSLPSAPEQHFHADGRERGIVNVFVPLVDVPASM
FT                   GPTHFRRGSHAWDHDSPYLTREQRRAQEGAEDVVPELRRGSVLMYDYRVFHRGGANLTG
FT                   KRRPVAYVMYARDGTEDTWNFPDESVWDPDSTGAG"
     MVLTVTSLLE VDGCPPIKLR EERDNEDVPL RTGCRVWSCA RLLAEWLANR SGGGEDDGAG        60
     PIVVGRDVLE LGAGTGAVGL TCAALGASSV TMTDRDEAAL ALMHTNARIN GHYDASSTCE       120
     VCVQGLDWGD PATYIQGASY DLVVAADVLY LPEHCAALPD AVAAHLAPGG EVVVACGLRR       180
     AGLLEALVDS LRSVGLDDVC VDLGTLGLDP VDGADARNRA AAAVTASEHA HDGAQISAAG       240
     GYALVTASVK ADWKPPERLS ARAVADAKRE REEEERNEEE RNEAERNEAD RPRIRGEGNR       300
     TPGAVASETA ATREEDQLGG EPSEIDSDAN SAMGDFLDDF EDLGVDAGAP VTRAVPASDD       360
     DDEDEVDTLP PYRVHPSPAE VASGAPSAST IAAAADSLAR NGFVVLEAED GAGLVASDVL       420
     DSALAASDGY LDRLLAAAKA KGLRVDSDIF RFAELCSRAQ GGRRFDVTAE RRRCGNGGSI       480
     TLPPRPYPTS DDESAAAAAT DAWDGLRRAV DPWVSSALLR SGLMVENDGK GATFGVTAVG       540
     CVTSLPSAPE QHFHADGRER GIVNVFVPLV DVPASMGPTH FRRGSHAWDH DSPYLTREQR       600
     RAQEGAEDVV PELRRGSVLM YDYRVFHRGG ANLTGKRRPV AYVMYARDGT EDTWNFPDES       660
     VWDPDSTGAG                                                              670
//

If you have problems or comments...

PBIL Back to PBIL home page