(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE260

MICSR_1.PE260        Location/Qualifiers
FT   CDS             522478..523869
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636600"
FT                   /orf_name="MICPUN_56835"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="amino sugar metabolic process "
FT                   /biological_process="peptidoglycan turnover"
FT                   /protein_id="ACO61719.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006040"
FT                   /db_xref="GO:0009254"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniParc:UPI000199AC3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D7"
FT                   /transl_table=1
FT                   /translation="MTRRVGIGLTAGPSLATIDAALVEIDPNPIRLKPVELIEFLPVPV
FT                   PPDLRARLVVARSGAAATPAAMSELDTEVGKLLADAAKKVAGARLGEVEFIASCGMPVV
FT                   RTSASSEESKSDDGAGAPPEVVRIGDAAVLARDTAKCVVSDFVPAESDETGVFSTADAV
FT                   LFRHLLDDTRTVEWHRKPTADTSCALVVVHFGAMASMTALSGTGRVLRSFDCGPGNMVM
FT                   NLIVQNAAALGLEPKDPKDEALAEKLQQPGGMRFDEGGKIAKGGRVYHGRTKDAPIDFA
FT                   WTAPFFTRSPVRRGSEADFGMEFTKTFVNRFPKEPPVRFAEVGKEWRNVNDVVRTALEH
FT                   AALCVMEGIASHVGAVSGSGNHLMGHSGSTGRVLISGGGAYNWALMARLRELGWKNLRF
FT                   ETSTECGIRADAAQAMRAATLGYLTLSGVAGPGDGEAAEGAGGAALGKVYTPGGDPAPV
FT                   FEPVK"
     MTRRVGIGLT AGPSLATIDA ALVEIDPNPI RLKPVELIEF LPVPVPPDLR ARLVVARSGA        60
     AATPAAMSEL DTEVGKLLAD AAKKVAGARL GEVEFIASCG MPVVRTSASS EESKSDDGAG       120
     APPEVVRIGD AAVLARDTAK CVVSDFVPAE SDETGVFSTA DAVLFRHLLD DTRTVEWHRK       180
     PTADTSCALV VVHFGAMASM TALSGTGRVL RSFDCGPGNM VMNLIVQNAA ALGLEPKDPK       240
     DEALAEKLQQ PGGMRFDEGG KIAKGGRVYH GRTKDAPIDF AWTAPFFTRS PVRRGSEADF       300
     GMEFTKTFVN RFPKEPPVRF AEVGKEWRNV NDVVRTALEH AALCVMEGIA SHVGAVSGSG       360
     NHLMGHSGST GRVLISGGGA YNWALMARLR ELGWKNLRFE TSTECGIRAD AAQAMRAATL       420
     GYLTLSGVAG PGDGEAAEGA GGAALGKVYT PGGDPAPVFE PVK                         463
//

If you have problems or comments...

PBIL Back to PBIL home page