(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE261

MICSR_1.PE261        Location/Qualifiers
FT   CDS             524138..525628
FT                   /codon_start=1
FT                   /gene_family="HOG000006181" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636601"
FT                   /orf_name="MICPUN_113552"
FT                   /product="PfkB family carbohydrate kinase "
FT                   /function="ribokinase activity"
FT                   /biological_process="D-ribose metabolic process "
FT                   /protein_id="ACO61720.1"
FT                   /db_xref="GO:0004747"
FT                   /db_xref="GO:0006014"
FT                   /db_xref="HOGENOM:HBG560095"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI000199ACAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D8"
FT                   /transl_table=1
FT                   /translation="MQSLQAPTLALGVSEGAKRRAVAGSRLARPVSVRHHRRVAIRNNA
FT                   VFADADQAQRWIDAWKARLNAPRVVGVGSAGVDYLASVAAFPEPDQKLRTDAFETQGGG
FT                   NCGNALTAVARLGLRPSILTKLSDDGAGKAILDELRDDGVDTAHVVIEPGKSSPFTYII
FT                   VDREGSTRTCIHTPGPEFTPKEMPLAAIERLLDGASLCYFDGRLTEVAIEVAKVAKARG
FT                   VPVLVEGERLRDNLPALLALGDYVCTSANYPQDSNPDAPGFEAAMVAMASKLPAAKAIV
FT                   TTLGSRGAVCLVRAPAQAGKAPSRAESLADVVSKLEKDAAVGMPAGSRGVPVPAWPVVS
FT                   DAVVLTDAGDEAAAALGAVEVIFAPAVKLQKSSVVDTTGAGDAFIGSMCYGVATGMELK
FT                   DAMRLGAYVAAKKCGSLGARPGLPDISEVPEAVFQGKEKPKVAAAAVNKTASRPPAVRK
FT                   AKAPREMTDIDKEFADGTRKSIAPGLSKWMLKLGRRYQ"
     MQSLQAPTLA LGVSEGAKRR AVAGSRLARP VSVRHHRRVA IRNNAVFADA DQAQRWIDAW        60
     KARLNAPRVV GVGSAGVDYL ASVAAFPEPD QKLRTDAFET QGGGNCGNAL TAVARLGLRP       120
     SILTKLSDDG AGKAILDELR DDGVDTAHVV IEPGKSSPFT YIIVDREGST RTCIHTPGPE       180
     FTPKEMPLAA IERLLDGASL CYFDGRLTEV AIEVAKVAKA RGVPVLVEGE RLRDNLPALL       240
     ALGDYVCTSA NYPQDSNPDA PGFEAAMVAM ASKLPAAKAI VTTLGSRGAV CLVRAPAQAG       300
     KAPSRAESLA DVVSKLEKDA AVGMPAGSRG VPVPAWPVVS DAVVLTDAGD EAAAALGAVE       360
     VIFAPAVKLQ KSSVVDTTGA GDAFIGSMCY GVATGMELKD AMRLGAYVAA KKCGSLGARP       420
     GLPDISEVPE AVFQGKEKPK VAAAAVNKTA SRPPAVRKAK APREMTDIDK EFADGTRKSI       480
     APGLSKWMLK LGRRYQ                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page