(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE263

MICSR_1.PE263        Location/Qualifiers
FT   CDS             528027..528515
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636603"
FT                   /orf_name="MICPUN_56838"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61721.1"
FT                   /db_xref="UniParc:UPI000199ACAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E0"
FT                   /transl_table=1
FT                   /translation="MKIRAAKKKQNKKVKAAKARAKHAREQRKKAAAGAGRDGDDDHEM
FT                   DAADAEVNAADEDVAIAEAASENPKLSGRAARALAVQARRTLKQKLSQLKDQRQKIAKK
FT                   SIARRDERKALGAKIKAAFQVSKNSTGDAEALLRAAEDLPDDDDDDNWADEDVEMAMD"
     MKIRAAKKKQ NKKVKAAKAR AKHAREQRKK AAAGAGRDGD DDHEMDAADA EVNAADEDVA        60
     IAEAASENPK LSGRAARALA VQARRTLKQK LSQLKDQRQK IAKKSIARRD ERKALGAKIK       120
     AAFQVSKNST GDAEALLRAA EDLPDDDDDD NWADEDVEMA MD                          162
//

If you have problems or comments...

PBIL Back to PBIL home page