(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE264

MICSR_1.PE264        Location/Qualifiers
FT   CDS             complement(529619..529954)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636604"
FT                   /orf_name="MICPUN_107897"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62155.1"
FT                   /db_xref="UniParc:UPI000199ACAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E1"
FT                   /transl_table=1
FT                   /translation="MTEVFCEEQGEGATGTFRTLGVSGALNAAVAVAAETANAPPAARG
FT                   RGGSAAKPTGGESVCQSERDSRPGYEYLTAAELRRVGAKMSVGGRGLERVERSGGQYYL
FT                   QSARDYD"
     MTEVFCEEQG EGATGTFRTL GVSGALNAAV AVAAETANAP PAARGRGGSA AKPTGGESVC        60
     QSERDSRPGY EYLTAAELRR VGAKMSVGGR GLERVERSGG QYYLQSARDY D                111
//

If you have problems or comments...

PBIL Back to PBIL home page