(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE265

MICSR_1.PE265        Location/Qualifiers
FT   CDS             531669..532547
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636605"
FT                   /orf_name="MICPUN_56841"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61722.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199ACAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E2"
FT                   /transl_table=1
FT                   /translation="MNTIWHPLLLNRDPIVVKEESDDDHHNPPAVNVEPPADDHGEDEK
FT                   TEDLAGKMSTIWRPNLGRLYASVAEMEGSESEEEKEDATKKGVKRKRAPRTKGPCEHGV
FT                   KYRSNCKVCGACPHGKWRSRCKECGGSGICEHGRQRSKCKECGGASICEHSRQRSQCKE
FT                   CGGSQICKHGRRRSRCKECGGSGICEHGRQRSKCKECGGSQICEHDRIRSQCKECGGSQ
FT                   ICKHGRRRHYCKECGGSQICEHGRQRHRCKECGGSQICEHDRIRSQCKECGGSEICEHG
FT                   RRRSECKECKK"
     MNTIWHPLLL NRDPIVVKEE SDDDHHNPPA VNVEPPADDH GEDEKTEDLA GKMSTIWRPN        60
     LGRLYASVAE MEGSESEEEK EDATKKGVKR KRAPRTKGPC EHGVKYRSNC KVCGACPHGK       120
     WRSRCKECGG SGICEHGRQR SKCKECGGAS ICEHSRQRSQ CKECGGSQIC KHGRRRSRCK       180
     ECGGSGICEH GRQRSKCKEC GGSQICEHDR IRSQCKECGG SQICKHGRRR HYCKECGGSQ       240
     ICEHGRQRHR CKECGGSQIC EHDRIRSQCK ECGGSEICEH GRRRSECKEC KK               292
//

If you have problems or comments...

PBIL Back to PBIL home page