(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE266

MICSR_1.PE266        Location/Qualifiers
FT   CDS             complement(<534147..>534443)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636606"
FT                   /orf_name="MICPUN_76642"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62156.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199ACB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E3"
FT                   /transl_table=1
FT                   /translation="LETVRNLVFLDLYANAVEKIAGLECVPQLRVLMLGRNRIRSIGAG
FT                   LARLQRLDVLDLHNNEIASTSGLNSLASLRILNLAGNRLVSLGDLGNMTGLHEL"
     LETVRNLVFL DLYANAVEKI AGLECVPQLR VLMLGRNRIR SIGAGLARLQ RLDVLDLHNN        60
     EIASTSGLNS LASLRILNLA GNRLVSLGDL GNMTGLHEL                               99
//

If you have problems or comments...

PBIL Back to PBIL home page