(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE267

MICSR_1.PE267        Location/Qualifiers
FT   CDS             535341..536705
FT                   /codon_start=1
FT                   /gene_family="HOG000100024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636607"
FT                   /orf_name="MICPUN_99400"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61723.1"
FT                   /db_xref="HOGENOM:HBG560099"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniParc:UPI000199ACB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E4"
FT                   /transl_table=1
FT                   /translation="MGKLGELMGDSWDNAVKNNPIPVITKKMRKPGETAAYVRAQGSSL
FT                   FGIAEGLGLQYRMGAYTQVDDDLLDEDPGLNQLLVSTGSSISQLFTQDMWERHRGVSRY
FT                   WRHLATITKSTVFNRIVEPVLLIAAWATFWCLWNGTLVPVVQAFGEATLEASSGVAIVE
FT                   RIAGITGGVKFTHAVAVLASLAAPVCVPSTAHALAGTALGLVLVFRTNSASARLNEARV
FT                   LLGNMVRLVRDLTRLCQYIPEGDRRCEGVRRSVVRYAAAIGLAIEAHMRKGRTRVDPDD
FT                   PTAFKVDPSRNLTRIFGETEAKRIVNLPGASHNLPMVMNAQASKELRRALKAGMPHMIH
FT                   RECEEMVAELGKISGGAERIISTPIPLSYTRHTSRSLMIWLLTLPFALWETFHWATVPA
FT                   VFALTYLTIGLDEIGIQIEEPFSVLPVKPLADVCERDVRALDQLLELGGFPEGDR"
     MGKLGELMGD SWDNAVKNNP IPVITKKMRK PGETAAYVRA QGSSLFGIAE GLGLQYRMGA        60
     YTQVDDDLLD EDPGLNQLLV STGSSISQLF TQDMWERHRG VSRYWRHLAT ITKSTVFNRI       120
     VEPVLLIAAW ATFWCLWNGT LVPVVQAFGE ATLEASSGVA IVERIAGITG GVKFTHAVAV       180
     LASLAAPVCV PSTAHALAGT ALGLVLVFRT NSASARLNEA RVLLGNMVRL VRDLTRLCQY       240
     IPEGDRRCEG VRRSVVRYAA AIGLAIEAHM RKGRTRVDPD DPTAFKVDPS RNLTRIFGET       300
     EAKRIVNLPG ASHNLPMVMN AQASKELRRA LKAGMPHMIH RECEEMVAEL GKISGGAERI       360
     ISTPIPLSYT RHTSRSLMIW LLTLPFALWE TFHWATVPAV FALTYLTIGL DEIGIQIEEP       420
     FSVLPVKPLA DVCERDVRAL DQLLELGGFP EGDR                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page