(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE27

MICSR_1.PE27         Location/Qualifiers
FT   CDS             complement(47829..48536)
FT                   /codon_start=1
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636032"
FT                   /orf_name="MICPUN_56599"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="ACO62042.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000199AABD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q4"
FT                   /transl_table=1
FT                   /translation="MADSRSNYSLTTFNSSGELVQIKHALAAVQSGATSLGIRAVNGVV
FT                   LATEKKLPSTLVDETTVEKIAQLTPEIGMTYSGMGPDFRVLTKKTRKETQVYYRTYHEL
FT                   VPCSQIVRETASVMQEFTQRGGVRPFGVSLLMAGFDSNGPQLYQVDPSGTYFAWKASAI
FT                   GKNMVNAKTFLEKRYSEDMELEDAIHTAILTLKEGFDGQISAENIEIGIVAEDRKFRVL
FT                   TSAEVADYLSEVE"
     MADSRSNYSL TTFNSSGELV QIKHALAAVQ SGATSLGIRA VNGVVLATEK KLPSTLVDET        60
     TVEKIAQLTP EIGMTYSGMG PDFRVLTKKT RKETQVYYRT YHELVPCSQI VRETASVMQE       120
     FTQRGGVRPF GVSLLMAGFD SNGPQLYQVD PSGTYFAWKA SAIGKNMVNA KTFLEKRYSE       180
     DMELEDAIHT AILTLKEGFD GQISAENIEI GIVAEDRKFR VLTSAEVADY LSEVE            235
//

If you have problems or comments...

PBIL Back to PBIL home page