(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE270

MICSR_1.PE270        Location/Qualifiers
FT   CDS             join(541087..541089,541348..541554)
FT                   /codon_start=1
FT                   /gene_family="HOG000244095" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636610"
FT                   /orf_name="MICPUN_56846"
FT                   /product="Ribosomal membrane protein "
FT                   /protein_id="ACO61725.1"
FT                   /db_xref="HOGENOM:HBG560102"
FT                   /db_xref="InterPro:IPR010580"
FT                   /db_xref="UniParc:UPI000199ACB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E7"
FT                   /transl_table=1
FT                   /translation="MAASKRVFAASSAKFHKNIHKRGLVDIKAKEKSKYGFSVGPVMLG
FT                   FFVFVVIGSSLLQIIRTASAGGPM"
     MAASKRVFAA SSAKFHKNIH KRGLVDIKAK EKSKYGFSVG PVMLGFFVFV VIGSSLLQII        60
     RTASAGGPM                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page