(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE271

MICSR_1.PE271        Location/Qualifiers
FT   CDS             complement(541686..543254)
FT                   /codon_start=1
FT                   /gene_family="HOG000264642" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636611"
FT                   /orf_name="MICPUN_56847"
FT                   /product="Major facilitator superfamily "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62158.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG609118"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199ACB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E8"
FT                   /transl_table=1
FT                   /translation="MLFMIASLAALGGFLFGYDLGLIAGALLYMEPDLRLTEASEELIV
FT                   GMAKLGAVFGTFVGGALMQEHGRRKAIAWNSGFFLLGPFIMAVGDDAATVSLGRFVVGM
FT                   GVGASAVVVPAYVAEMAPKDRRGSVVTVYELMVCLGMITSGLVDWGLRGVEHSWRWMVA
FT                   MPMFPAVLMLAGSAALPESPRWLVIRGRLRDALDVIHSLREGSGVDRDGEDVSTAAVEA
FT                   ELMELWSAVEKERAQVGEPAGEPDASAAADVGAAADVPAQKSATSSGIHGRGMLAVGIQ
FT                   MLRDIRGLTSGPERNAFAIALWLAFFNQATCSTSVINFAPEVLERVGVDSKDDAVLLAS
FT                   AVSLCKLLGVSASMFLVDRAGRRTLLLVGSHAAAAAMAGLAIAYDAGDAFGSLLCMCVF
FT                   MLAFSASWAGVFWVVLSELFSMRVKSAAVSAAAATLFATGAFTDFVFLSAARAMGGWAF
FT                   GAVACVCVCAGVYVQRNLPETAGKSLAEVQAVMAAGTGARGEGPGWLTRLRRGPAAGGR
FT                   YVEMS"
     MLFMIASLAA LGGFLFGYDL GLIAGALLYM EPDLRLTEAS EELIVGMAKL GAVFGTFVGG        60
     ALMQEHGRRK AIAWNSGFFL LGPFIMAVGD DAATVSLGRF VVGMGVGASA VVVPAYVAEM       120
     APKDRRGSVV TVYELMVCLG MITSGLVDWG LRGVEHSWRW MVAMPMFPAV LMLAGSAALP       180
     ESPRWLVIRG RLRDALDVIH SLREGSGVDR DGEDVSTAAV EAELMELWSA VEKERAQVGE       240
     PAGEPDASAA ADVGAAADVP AQKSATSSGI HGRGMLAVGI QMLRDIRGLT SGPERNAFAI       300
     ALWLAFFNQA TCSTSVINFA PEVLERVGVD SKDDAVLLAS AVSLCKLLGV SASMFLVDRA       360
     GRRTLLLVGS HAAAAAMAGL AIAYDAGDAF GSLLCMCVFM LAFSASWAGV FWVVLSELFS       420
     MRVKSAAVSA AAATLFATGA FTDFVFLSAA RAMGGWAFGA VACVCVCAGV YVQRNLPETA       480
     GKSLAEVQAV MAAGTGARGE GPGWLTRLRR GPAAGGRYVE MS                          522
//

If you have problems or comments...

PBIL Back to PBIL home page