(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE272

MICSR_1.PE272        Location/Qualifiers
FT   CDS             543380..544528
FT                   /codon_start=1
FT                   /gene_family="HOG000264643" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636612"
FT                   /orf_name="MICPUN_56848"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61726.1"
FT                   /db_xref="HOGENOM:HBG560103"
FT                   /db_xref="UniParc:UPI000199ACB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E9"
FT                   /transl_table=1
FT                   /translation="MSGSPPLTPSRAEGDVKGLRRGMNALATMNGARAMAPSGAVARAR
FT                   APDTRATASRVYARRVGTSRGTLLAKVPSRLGRPHSWRPQLPPKRRRAITRAADDPERR
FT                   RPGFNKKRLASPKFSEEAQTWALLGGIATSLTAIVAVVVAANNEAAYFGSPDDFSYMGD
FT                   DFTGGPSLDVSPGNVAAAAIWSFGLFFKSPLQILLVFLGRTDTERPSDWLLRKSSGVTE
FT                   ETRTWEEASAPQKAALIAFFTVCGCGVVSGIDALFAGEETWALSAGLGFTMLAFVAELG
FT                   SPRRYSRAELDVLEAQYDDFVAFADEALERRGRCHGSEVERAFRRRFGKYTEAVLSDRD
FT                   LRTMILNWHPNAERTSSGYYKNLSVKEGVDRRNPVTVKDLGL"
     MSGSPPLTPS RAEGDVKGLR RGMNALATMN GARAMAPSGA VARARAPDTR ATASRVYARR        60
     VGTSRGTLLA KVPSRLGRPH SWRPQLPPKR RRAITRAADD PERRRPGFNK KRLASPKFSE       120
     EAQTWALLGG IATSLTAIVA VVVAANNEAA YFGSPDDFSY MGDDFTGGPS LDVSPGNVAA       180
     AAIWSFGLFF KSPLQILLVF LGRTDTERPS DWLLRKSSGV TEETRTWEEA SAPQKAALIA       240
     FFTVCGCGVV SGIDALFAGE ETWALSAGLG FTMLAFVAEL GSPRRYSRAE LDVLEAQYDD       300
     FVAFADEALE RRGRCHGSEV ERAFRRRFGK YTEAVLSDRD LRTMILNWHP NAERTSSGYY       360
     KNLSVKEGVD RRNPVTVKDL GL                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page