(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE273

MICSR_1.PE273        Location/Qualifiers
FT   CDS             544717..546186
FT                   /codon_start=1
FT                   /gene_family="HOG000180745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636613"
FT                   /orf_name="MICPUN_56849"
FT                   /product="RNA binding protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61727.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG558924"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006529"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199ACB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F0"
FT                   /transl_table=1
FT                   /translation="MPEERERSRDRRDRRRDDSRDRRRRRSYSRSRSRSATPPPRQRRR
FT                   PTGFSDAPPPGFSGADGAVGGAGVPPGMGIGGADIPPGMNVSVAGAPSGFSGPPPGYAN
FT                   AHPGNLGLNPVPNQQATRHARRVYVGNLPGTVTEPKVAAFFNNAMHAIGGTVAALPGDP
FT                   VLNVYINYEKKFAFVEFRTVEETSNCMALDGAVLEGIAMRVRRPNDYNVMAASSLGPSQ
FT                   PKDGLNLEAIGLNPAAAGGGGAGAANASLTEEDLQHRLFIGGLPYFLTETMVKELVEAF
FT                   GPTKQFQLVVDRETGNSKGYGFFVYQDHSVTDVACQGLHGMKMGEKSLTVQRAMQGGAG
FT                   APKPTAASVGPGHTALPGADEVAAHLAGASGAPAGLSVPPPPSEHPASRVVSLTEMLDV
FT                   EELRDDVEYGEIMEDMREECGKFGRIESIVIPRPGDADGAAVPGLGKVFVRYEDDAGAA
FT                   AARNALHGRKFGGNVVKADFIDETVFASRAF"
     MPEERERSRD RRDRRRDDSR DRRRRRSYSR SRSRSATPPP RQRRRPTGFS DAPPPGFSGA        60
     DGAVGGAGVP PGMGIGGADI PPGMNVSVAG APSGFSGPPP GYANAHPGNL GLNPVPNQQA       120
     TRHARRVYVG NLPGTVTEPK VAAFFNNAMH AIGGTVAALP GDPVLNVYIN YEKKFAFVEF       180
     RTVEETSNCM ALDGAVLEGI AMRVRRPNDY NVMAASSLGP SQPKDGLNLE AIGLNPAAAG       240
     GGGAGAANAS LTEEDLQHRL FIGGLPYFLT ETMVKELVEA FGPTKQFQLV VDRETGNSKG       300
     YGFFVYQDHS VTDVACQGLH GMKMGEKSLT VQRAMQGGAG APKPTAASVG PGHTALPGAD       360
     EVAAHLAGAS GAPAGLSVPP PPSEHPASRV VSLTEMLDVE ELRDDVEYGE IMEDMREECG       420
     KFGRIESIVI PRPGDADGAA VPGLGKVFVR YEDDAGAAAA RNALHGRKFG GNVVKADFID       480
     ETVFASRAF                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page