(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE275

MICSR_1.PE275        Location/Qualifiers
FT   CDS             547768..550143
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636905"
FT                   /orf_name="MICPUN_56851"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61728.1"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199ACB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F2"
FT                   /transl_table=1
FT                   /translation="MPRKRPKKNADDDGGSDECPLLSLAHQVMTPIAAHLDGDDLSALA
FT                   RTCVAMRRLCDGPQGRIWWRDACVRLLGKTHCAVHLRAWGGPDGGYDDARLWRQLHRHA
FT                   SFPVSFSWHAGLGGSLWEGVQNKDEAARREALRRAEARLGPLEEYDEDVDWVEQDDDTS
FT                   YTGAAILPRSDRARADVAERGPLAVAPQLSPDLARSGHTSTLIDELGLMVVVGGMMLVS
FT                   MVAGDNEHPPAPPDFNGGDEGDVKVHAVRLPEMQVVAPDVMNWTSASEARDEEDPMSAK
FT                   EPCEVPASRFRHQTIDASLPLGSRLSWNAFGDDGRGWGADGTDYSKGATLLVHGGYDGI
FT                   SRCFEKVYLLRVARDGSRCLWGDPGAPTNLVNGERMPRVFHHTLTRLRNSPRAISIGGQ
FT                   TDEDQRTQDDLGHGAVHEMNLDTWTWTRRETNGWPARQVGEMDVTLTSRWLHIAALRPP
FT                   RERRVYRNWTQWNRNSYLYAPVPRDTRVRKHSYKEAMAVMSPYMTKLERAQGEQIVIVG
FT                   GYDDSPDSAIGTMEPWVLDVESWTWHRSYWGPDNYESHTPDGEFIQYIPDGRHRAGSCM
FT                   IGQNLLLVHGGMGKSLMFGGINMLDESDSCVLDLSTLTWIHPDQGLHPRDSGLMFDDAW
FT                   QSVRLRSVAGHTLEGMLAFGGCELGFMRQPTPIAKMDFLILGPTPGVGCSRSPRNKLLY
FT                   YAAAPIGKLQRDSWRSLFRTASERVSKYRVRGFHRIVIDGRERRVMLLEHRDGSKGGLV
FT                   SVRHIGNHGSFCDERWSFWYEDSDSDFHSSSASDEDSD"
     MPRKRPKKNA DDDGGSDECP LLSLAHQVMT PIAAHLDGDD LSALARTCVA MRRLCDGPQG        60
     RIWWRDACVR LLGKTHCAVH LRAWGGPDGG YDDARLWRQL HRHASFPVSF SWHAGLGGSL       120
     WEGVQNKDEA ARREALRRAE ARLGPLEEYD EDVDWVEQDD DTSYTGAAIL PRSDRARADV       180
     AERGPLAVAP QLSPDLARSG HTSTLIDELG LMVVVGGMML VSMVAGDNEH PPAPPDFNGG       240
     DEGDVKVHAV RLPEMQVVAP DVMNWTSASE ARDEEDPMSA KEPCEVPASR FRHQTIDASL       300
     PLGSRLSWNA FGDDGRGWGA DGTDYSKGAT LLVHGGYDGI SRCFEKVYLL RVARDGSRCL       360
     WGDPGAPTNL VNGERMPRVF HHTLTRLRNS PRAISIGGQT DEDQRTQDDL GHGAVHEMNL       420
     DTWTWTRRET NGWPARQVGE MDVTLTSRWL HIAALRPPRE RRVYRNWTQW NRNSYLYAPV       480
     PRDTRVRKHS YKEAMAVMSP YMTKLERAQG EQIVIVGGYD DSPDSAIGTM EPWVLDVESW       540
     TWHRSYWGPD NYESHTPDGE FIQYIPDGRH RAGSCMIGQN LLLVHGGMGK SLMFGGINML       600
     DESDSCVLDL STLTWIHPDQ GLHPRDSGLM FDDAWQSVRL RSVAGHTLEG MLAFGGCELG       660
     FMRQPTPIAK MDFLILGPTP GVGCSRSPRN KLLYYAAAPI GKLQRDSWRS LFRTASERVS       720
     KYRVRGFHRI VIDGRERRVM LLEHRDGSKG GLVSVRHIGN HGSFCDERWS FWYEDSDSDF       780
     HSSSASDEDS D                                                            791
//

If you have problems or comments...

PBIL Back to PBIL home page