(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE276

MICSR_1.PE276        Location/Qualifiers
FT   CDS             complement(550283..551188)
FT                   /codon_start=1
FT                   /gene_family="HOG000034586" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636906"
FT                   /orf_name="MICPUN_79714"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62160.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG704164"
FT                   /db_xref="InterPro:IPR000097"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="UniParc:UPI000199A5C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F3"
FT                   /transl_table=1
FT                   /translation="MRWDVTDPPLPPRAPRLDRALHPSKLTVLSWNVNSIRALLDKDPD
FT                   ILDEVAASEDADVVLLQETKLQEKHVPEMDARVLAKYPYRTWNCSTSRLGYSGTAMFLR
FT                   LEPTRAPWHDPFEMDEFEGEGRVVCAELPNVFVVGAYCPNSGEGLARLRARTKEWDPRM
FT                   SAYLSSLQASAGGKPVVYCGDLNVANEPIDLWGNHAANSLASGYTPEERDSFKRLLLGP
FT                   IRDGGAGLVDTFREAHGTDAKAFTYFSYRAGARPRNRGWRIDYALVSESLRGEVHDAFI
FT                   RGDVGGSDHCPIGVVVKLRE"
     MRWDVTDPPL PPRAPRLDRA LHPSKLTVLS WNVNSIRALL DKDPDILDEV AASEDADVVL        60
     LQETKLQEKH VPEMDARVLA KYPYRTWNCS TSRLGYSGTA MFLRLEPTRA PWHDPFEMDE       120
     FEGEGRVVCA ELPNVFVVGA YCPNSGEGLA RLRARTKEWD PRMSAYLSSL QASAGGKPVV       180
     YCGDLNVANE PIDLWGNHAA NSLASGYTPE ERDSFKRLLL GPIRDGGAGL VDTFREAHGT       240
     DAKAFTYFSY RAGARPRNRG WRIDYALVSE SLRGEVHDAF IRGDVGGSDH CPIGVVVKLR       300
     E                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page