(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE277

MICSR_1.PE277        Location/Qualifiers
FT   CDS             join(552359..553129,553181..553516)
FT                   /codon_start=1
FT                   /gene_family="HOG000030179" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636907"
FT                   /orf_name="MICPUN_97136"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO61729.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG560106"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniParc:UPI000199A5CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F4"
FT                   /transl_table=1
FT                   /translation="MGARLPEPTEGPGACKVWEIKTLGRADDERARDMLEKTAWQVQPI
FT                   MRKRGWKVQELCEMKPEQRDRMGDNLNMGQRVRLKLRKNNSGDWFDYDHVVLVMLHELC
FT                   HNDIGPHNAKFFKLLDEITVECEELMAKGIGGSGAGFDAKGQRLGHRGGWGGIETRDPR
FT                   KAAAEAAARRAGYQAAMGPAGGRKLGGGGTGAATQLGPREAAAAAAERRLRAERFAREN
FT                   GLMNDVVVIDDEDDDDGGDGDGAGEGGGMAKTAPARNEGAEVVVLSSPQEPGTRDAGKR
FT                   KRTSGRRADEDDEEEAEKEETDDDDDVVFVQAVPAPRPGVDRPERRWTCSQCTLVNPER
FT                   ATHCGACERWRFGRGAPAASRPTVGVDD"
     MGARLPEPTE GPGACKVWEI KTLGRADDER ARDMLEKTAW QVQPIMRKRG WKVQELCEMK        60
     PEQRDRMGDN LNMGQRVRLK LRKNNSGDWF DYDHVVLVML HELCHNDIGP HNAKFFKLLD       120
     EITVECEELM AKGIGGSGAG FDAKGQRLGH RGGWGGIETR DPRKAAAEAA ARRAGYQAAM       180
     GPAGGRKLGG GGTGAATQLG PREAAAAAAE RRLRAERFAR ENGLMNDVVV IDDEDDDDGG       240
     DGDGAGEGGG MAKTAPARNE GAEVVVLSSP QEPGTRDAGK RKRTSGRRAD EDDEEEAEKE       300
     ETDDDDDVVF VQAVPAPRPG VDRPERRWTC SQCTLVNPER ATHCGACERW RFGRGAPAAS       360
     RPTVGVDD                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page