(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE278

MICSR_1.PE278        Location/Qualifiers
FT   CDS             join(complement(554616..554744),complement(553601..554533))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636908"
FT                   /orf_name="MICPUN_56854"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /biological_process="rRNA processing"
FT                   /protein_id="ACO62161.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG611222"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="UniParc:UPI000199A5CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F5"
FT                   /transl_table=1
FT                   /translation="MRAAPARVGPPVRVARGPRRAAGRRSIRGVRVECRNRILFRREVD
FT                   ESDDGAESITLALGDSRSEHVRGVLKLAAGDSLRVGVVNGSPATAVVSTMDATSMTLTW
FT                   RPGVETDDGDTARRSLTAPLVDVDLLLAMPRPKVMTRLWAPLASIGVRNVYLTNASRVE
FT                   RYYWDSTALDEAKVIAELTRGMEQSGDVRMPGVCVVRRFPAAVDAVREMTGAPRRDGGQ
FT                   EPRGRGGREGGGNGGGMPREGSAFWLVKPPPADENDDDAEVVMLTAHPGAAATVGDAFG
FT                   DLSSSSSSSSSGRPRRTRAVVAVGPEGGWTDFERRSLLDAGFVEVALGRRTFATDVACV
FT                   ALVAAVRERTSSW"
     MRAAPARVGP PVRVARGPRR AAGRRSIRGV RVECRNRILF RREVDESDDG AESITLALGD        60
     SRSEHVRGVL KLAAGDSLRV GVVNGSPATA VVSTMDATSM TLTWRPGVET DDGDTARRSL       120
     TAPLVDVDLL LAMPRPKVMT RLWAPLASIG VRNVYLTNAS RVERYYWDST ALDEAKVIAE       180
     LTRGMEQSGD VRMPGVCVVR RFPAAVDAVR EMTGAPRRDG GQEPRGRGGR EGGGNGGGMP       240
     REGSAFWLVK PPPADENDDD AEVVMLTAHP GAAATVGDAF GDLSSSSSSS SSGRPRRTRA       300
     VVAVGPEGGW TDFERRSLLD AGFVEVALGR RTFATDVACV ALVAAVRERT SSW              353
//

If you have problems or comments...

PBIL Back to PBIL home page