(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE28

MICSR_1.PE28         Location/Qualifiers
FT   CDS             complement(48814..49737)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636033"
FT                   /orf_name="MICPUN_56600"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62043.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AABE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q5"
FT                   /transl_table=1
FT                   /translation="MEGAPIDEAPASGQEPVGAPHEENPPHNDDNPVTKLFKDMGTKVK
FT                   NVVAAVERMEEEVIDDKTVNDKVKAIQHTRNVKTLRQMWIDLILSKEFTTIIDQVFDKC
FT                   CKLNDDDGDGHEGDGKLDRTELGAAMTMLWERLDQKTGGGKKLPRIKESEETVLRRYDA
FT                   DSDGHLDRDEFHGFARTYFSRVEWSSWRVACHGATKGFGFYVAQRMLLQPAIGMVKTAV
FT                   GPIVKAKIQKALESGAASVLRGSLRKVKYAVKRPLAKTNNAEGKAILEEELMEMRAKAR
FT                   AKLVALVKSVAICCVGGSVGAVAGWL"
     MEGAPIDEAP ASGQEPVGAP HEENPPHNDD NPVTKLFKDM GTKVKNVVAA VERMEEEVID        60
     DKTVNDKVKA IQHTRNVKTL RQMWIDLILS KEFTTIIDQV FDKCCKLNDD DGDGHEGDGK       120
     LDRTELGAAM TMLWERLDQK TGGGKKLPRI KESEETVLRR YDADSDGHLD RDEFHGFART       180
     YFSRVEWSSW RVACHGATKG FGFYVAQRML LQPAIGMVKT AVGPIVKAKI QKALESGAAS       240
     VLRGSLRKVK YAVKRPLAKT NNAEGKAILE EELMEMRAKA RAKLVALVKS VAICCVGGSV       300
     GAVAGWL                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page