(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE280

MICSR_1.PE280        Location/Qualifiers
FT   CDS             557675..558502
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636910"
FT                   /orf_name="MICPUN_56856"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61731.1"
FT                   /db_xref="HOGENOM:HBG609227"
FT                   /db_xref="UniParc:UPI000199A5CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F7"
FT                   /transl_table=1
FT                   /translation="MAAIYASRVMPRSGAAAARSPRRSRLSPGPRLIASPRRQISSRSG
FT                   GSDSSGGVGESARDAALRMEQEALDARTAIRLASLRAQKDEERAIQQRAVELQKEMAIR
FT                   EEGRRRAEETGGRRPTQRKAVPIFIAGVQCTAMSLASLTLTNRAAAFLVDGDVPVANRT
FT                   LLVNLSVGGGVAVTATLIISTLILFTVAIKEGLGVINNTPVTFYRCDGQGPTCCKNGPH
FT                   NLGYAAKFTYLANGRGFETRQRDSMRRHLLVSRKCRELKPIVIYPKEEGWKLW"
     MAAIYASRVM PRSGAAAARS PRRSRLSPGP RLIASPRRQI SSRSGGSDSS GGVGESARDA        60
     ALRMEQEALD ARTAIRLASL RAQKDEERAI QQRAVELQKE MAIREEGRRR AEETGGRRPT       120
     QRKAVPIFIA GVQCTAMSLA SLTLTNRAAA FLVDGDVPVA NRTLLVNLSV GGGVAVTATL       180
     IISTLILFTV AIKEGLGVIN NTPVTFYRCD GQGPTCCKNG PHNLGYAAKF TYLANGRGFE       240
     TRQRDSMRRH LLVSRKCREL KPIVIYPKEE GWKLW                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page