(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE281

MICSR_1.PE281        Location/Qualifiers
FT   CDS             join(complement(559115..559588),complement(558650..558991))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636911"
FT                   /orf_name="MICPUN_107900"
FT                   /product="Predicted protein"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO62162.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniParc:UPI000199A5CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F8"
FT                   /transl_table=1
FT                   /translation="MRRLGASSAYTAVPTDLHSEGAEGAEGAEESPAESPAESPADDAP
FT                   TDVSLDVKLSFRRLPKGTWVKLQPRSADFQGELATDNSVDLRELLEATLHRRCALTVGD
FT                   DVSVRAHGDREYALRVVEVLPDDADGAVSLVETDVEVDIAPSEDYEDAMRRLAEAAAAA
FT                   RAERYRAAVSERLPVEPDADAAGGCVPCRFQLPDGRTVTRRFAPTDPLAAVFDYVISAG
FT                   GAGEGEAFRLVTRWPRTVTELDDGARTVRAAGLKPADTLFVEKLEKTAA"
     MRRLGASSAY TAVPTDLHSE GAEGAEGAEE SPAESPAESP ADDAPTDVSL DVKLSFRRLP        60
     KGTWVKLQPR SADFQGELAT DNSVDLRELL EATLHRRCAL TVGDDVSVRA HGDREYALRV       120
     VEVLPDDADG AVSLVETDVE VDIAPSEDYE DAMRRLAEAA AAARAERYRA AVSERLPVEP       180
     DADAAGGCVP CRFQLPDGRT VTRRFAPTDP LAAVFDYVIS AGGAGEGEAF RLVTRWPRTV       240
     TELDDGARTV RAAGLKPADT LFVEKLEKTA A                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page