(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE282

MICSR_1.PE282        Location/Qualifiers
FT   CDS             <560601..>560996
FT                   /codon_start=1
FT                   /gene_family="HOG000264651" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636912"
FT                   /orf_name="MICPUN_72902"
FT                   /product="Mitochondrial protein translocase family "
FT                   /protein_id="ACO61732.1"
FT                   /db_xref="HOGENOM:HBG593865"
FT                   /db_xref="InterPro:IPR013261"
FT                   /db_xref="UniParc:UPI000199A5CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F9"
FT                   /transl_table=1
FT                   /translation="IPEKPVSAVEAGGYGIVIAAALAVALGAIWFSFKELIFEPKEQTV
FT                   FNRALDKIAVDPRVTVRVGTPMTGYGREGRSRSARQHVPHVVHVDGAGREHVRIQGAVR
FT                   GPQGKATVHADAYKGDSGEWEFAYLLVD"
     IPEKPVSAVE AGGYGIVIAA ALAVALGAIW FSFKELIFEP KEQTVFNRAL DKIAVDPRVT        60
     VRVGTPMTGY GREGRSRSAR QHVPHVVHVD GAGREHVRIQ GAVRGPQGKA TVHADAYKGD       120
     SGEWEFAYLL VD                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page