(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE283

MICSR_1.PE283        Location/Qualifiers
FT   CDS             561239..562222
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636913"
FT                   /orf_name="MICPUN_56859"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO61733.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG750656"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199A5D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G0"
FT                   /transl_table=1
FT                   /translation="MLVARRWWSRIDVCAHAPRAASAVSWVLHRDADVLVVDKPAGVPM
FT                   RSVHGVKGVDAFLADLRFDLAHPPMTVHRLDRDTTGCLILARTREAQRTLAGYFQDRAR
FT                   VARRGSGRSTKTTSPESLGDVRRVYWALVSATSTLASRGTIDAALVTTHAGVTLKPGAG
FT                   AKPAATDYEVISRASPDSCAPTAAGRVPAVLALVPRTGRKHQLRVHCAGALDAAIVGDY
FT                   KYGYRDVSRTGGVADDWRRVLRDIDERSTRRLNDAGTADGEVRGAGVPLHLHARCVEFT
FT                   HPSSGERVRVVAPAPSHMSLACEALGLALDGGDDDGLGLLLHFNRR"
     MLVARRWWSR IDVCAHAPRA ASAVSWVLHR DADVLVVDKP AGVPMRSVHG VKGVDAFLAD        60
     LRFDLAHPPM TVHRLDRDTT GCLILARTRE AQRTLAGYFQ DRARVARRGS GRSTKTTSPE       120
     SLGDVRRVYW ALVSATSTLA SRGTIDAALV TTHAGVTLKP GAGAKPAATD YEVISRASPD       180
     SCAPTAAGRV PAVLALVPRT GRKHQLRVHC AGALDAAIVG DYKYGYRDVS RTGGVADDWR       240
     RVLRDIDERS TRRLNDAGTA DGEVRGAGVP LHLHARCVEF THPSSGERVR VVAPAPSHMS       300
     LACEALGLAL DGGDDDGLGL LLHFNRR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page