(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE284

MICSR_1.PE284        Location/Qualifiers
FT   CDS             562307..564067
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636914"
FT                   /orf_name="MICPUN_56860"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61734.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199A5D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G1"
FT                   /transl_table=1
FT                   /translation="MTAGEERPVVVKTRWVSAEEDEPSAPPRGNATAEERPSGGCFEAE
FT                   VSLPGVTSAESIVAEIVTAAEAGAPPSLYVRAKADGGGGASLSADVPLPDGCDHREISA
FT                   VKWSRKRSTLRVRFAASSPAAAGGAEDDGDDEDGAGPLAEYLRMLGVRDGEAGGSEPEL
FT                   EEDGDPRDGVRDPAGEKRENPSRADGKTPQPTEPTKQTPPGRAVRASGNKKKRRKNAAG
FT                   RGVAATPGRQLETPGRQLETTRPGVSLSELSDDLAAQLHARGFAHAQFITRDAVCVVRD
FT                   EIKRVAPLYTDGEIWLGKHDAGAQIAVKSVRGDRVFWMDPATADGGRFDAMRSMLRAID
FT                   ELVLDHLARACPKRLGGLADRTHAMLAEYPGRGSRFVRHVDNTGRDGRRLTVLCYLNPD
FT                   YAGEHGGALKVYDADDADGSRGVEVAPAAGTIAMFYADETPHEVLPSARSRHSFTVWYY
FT                   DETEFKDAETRRGEAAAADSRAAHMPSVDGSGGSDPGATLAALDASDREAQAFVRRMMT
FT                   QRLTPAGAAAAARGLGERALRTVATVFGAPDPASFVVALTQMSQSDLDELRMEITSMGM
FT                   DNAPDAELVA"
     MTAGEERPVV VKTRWVSAEE DEPSAPPRGN ATAEERPSGG CFEAEVSLPG VTSAESIVAE        60
     IVTAAEAGAP PSLYVRAKAD GGGGASLSAD VPLPDGCDHR EISAVKWSRK RSTLRVRFAA       120
     SSPAAAGGAE DDGDDEDGAG PLAEYLRMLG VRDGEAGGSE PELEEDGDPR DGVRDPAGEK       180
     RENPSRADGK TPQPTEPTKQ TPPGRAVRAS GNKKKRRKNA AGRGVAATPG RQLETPGRQL       240
     ETTRPGVSLS ELSDDLAAQL HARGFAHAQF ITRDAVCVVR DEIKRVAPLY TDGEIWLGKH       300
     DAGAQIAVKS VRGDRVFWMD PATADGGRFD AMRSMLRAID ELVLDHLARA CPKRLGGLAD       360
     RTHAMLAEYP GRGSRFVRHV DNTGRDGRRL TVLCYLNPDY AGEHGGALKV YDADDADGSR       420
     GVEVAPAAGT IAMFYADETP HEVLPSARSR HSFTVWYYDE TEFKDAETRR GEAAAADSRA       480
     AHMPSVDGSG GSDPGATLAA LDASDREAQA FVRRMMTQRL TPAGAAAAAR GLGERALRTV       540
     ATVFGAPDPA SFVVALTQMS QSDLDELRME ITSMGMDNAP DAELVA                      586
//

If you have problems or comments...

PBIL Back to PBIL home page