(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE286

MICSR_1.PE286        Location/Qualifiers
FT   CDS             complement(565542..565943)
FT                   /codon_start=1
FT                   /gene_family="HOG000232198" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636916"
FT                   /orf_name="MICPUN_99413"
FT                   /product="Predicted protein"
FT                   /biological_process="cell adhesion"
FT                   /protein_id="ACO62163.1"
FT                   /db_xref="GO:0007155"
FT                   /db_xref="HOGENOM:HBG560112"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniParc:UPI000199A5D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G3"
FT                   /transl_table=1
FT                   /translation="MTDMASPGAGASVVMATCSDERHPPHNALDEDERSFWVTTGLFPQ
FT                   EIVVKLGKTSQVTKVRTLTANVRKFSLEYCDDDEPIGFKPAFEVELGDKGPARLQTEVH
FT                   QVNCRAKFLKFVIGSGWGDFASVHRISVF"
     MTDMASPGAG ASVVMATCSD ERHPPHNALD EDERSFWVTT GLFPQEIVVK LGKTSQVTKV        60
     RTLTANVRKF SLEYCDDDEP IGFKPAFEVE LGDKGPARLQ TEVHQVNCRA KFLKFVIGSG       120
     WGDFASVHRI SVF                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page