(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE287

MICSR_1.PE287        Location/Qualifiers
FT   CDS             566677..567828
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636917"
FT                   /orf_name="MICPUN_79944"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61736.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199A5D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G4"
FT                   /transl_table=1
FT                   /translation="MENNGRVVELELKEFGLTGAVPAELGRLSALMDLNLGGNQLTLLP
FT                   AEIGQLASLESLELGYNELTSVPVEIWQLASLEGLYLGGNQLTSVPAEIGQLTSLEDLS
FT                   LEANRLTSVPTEIGQLTSLTQLDLRDNQLTSVPAEIWRLTSLTYLNLNDNQLTSVPAEI
FT                   RQLTSLRELWLSANHLTSVPAEIWQLAALVKLSVTENQLTSVPAEIWQLTSLTELYLHG
FT                   NQLTSVPAEIGQLTSLTALSLYDNQLTSVPAEIGQIRSLVKLSLHGNRLTSLPAEIGQL
FT                   RALVEFELDRNLLTSVPAEIGHLTSLTELSLHGNQLTSVPSEIGQLTSLGELSLSGNQL
FT                   TSVPAAMRELEAAGCYMDLDLDSDPEPEPEEEEGEPLDFDLFD"
     MENNGRVVEL ELKEFGLTGA VPAELGRLSA LMDLNLGGNQ LTLLPAEIGQ LASLESLELG        60
     YNELTSVPVE IWQLASLEGL YLGGNQLTSV PAEIGQLTSL EDLSLEANRL TSVPTEIGQL       120
     TSLTQLDLRD NQLTSVPAEI WRLTSLTYLN LNDNQLTSVP AEIRQLTSLR ELWLSANHLT       180
     SVPAEIWQLA ALVKLSVTEN QLTSVPAEIW QLTSLTELYL HGNQLTSVPA EIGQLTSLTA       240
     LSLYDNQLTS VPAEIGQIRS LVKLSLHGNR LTSLPAEIGQ LRALVEFELD RNLLTSVPAE       300
     IGHLTSLTEL SLHGNQLTSV PSEIGQLTSL GELSLSGNQL TSVPAAMREL EAAGCYMDLD       360
     LDSDPEPEPE EEEGEPLDFD LFD                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page