(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE288

MICSR_1.PE288        Location/Qualifiers
FT   CDS             567862..568251
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636918"
FT                   /orf_name="MICPUN_52198"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61737.1"
FT                   /db_xref="UniParc:UPI000199A5D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G5"
FT                   /transl_table=1
FT                   /translation="MNGRFALIRFKHPSTSREYRRTESRGGATRKNRKKRKVHPDSRAA
FT                   AARVEVADAVSTRSSPASASVHPARLLLFITRGSPRPRPPRARAPRGTPAPRTAPCPSP
FT                   VRWRWSRPSTGVSAARTRRRRCTCP"
     MNGRFALIRF KHPSTSREYR RTESRGGATR KNRKKRKVHP DSRAAAARVE VADAVSTRSS        60
     PASASVHPAR LLLFITRGSP RPRPPRARAP RGTPAPRTAP CPSPVRWRWS RPSTGVSAAR       120
     TRRRRCTCP                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page