(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE289

MICSR_1.PE289        Location/Qualifiers
FT   CDS             join(complement(570206..>570538),
FT                   complement(<569675..570145))
FT                   /codon_start=1
FT                   /gene_family="HOG000198014" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636919"
FT                   /orf_name="MICPUN_71782"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="ACO62164.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199A5D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G6"
FT                   /transl_table=1
FT                   /translation="RAFKSILNKLTPQNFEKLLEQVLAEGIDEAQTLIGLIGQLFDKAL
FT                   TEPTFAELYAMMCQQLSNRFLAENIEFVDPDCDPDAEGGPRMINFKRVLLNKCQEEFEK
FT                   GDSAIKAEEKEEGEVPAKPKTPEELELDERRKIQQREDRMRQARRRMLGNIRFIGELFK
FT                   KEMLTARIMHTCIMKLLNEKKNPDEEDVEALCKLMATIGRLIDRPDAKSHMDAYFKRIQ
FT                   GLSVNKSISSRHRFMCQDIMEMRSKGWRERRKQEGPKKIEDVHKDA"
     RAFKSILNKL TPQNFEKLLE QVLAEGIDEA QTLIGLIGQL FDKALTEPTF AELYAMMCQQ        60
     LSNRFLAENI EFVDPDCDPD AEGGPRMINF KRVLLNKCQE EFEKGDSAIK AEEKEEGEVP       120
     AKPKTPEELE LDERRKIQQR EDRMRQARRR MLGNIRFIGE LFKKEMLTAR IMHTCIMKLL       180
     NEKKNPDEED VEALCKLMAT IGRLIDRPDA KSHMDAYFKR IQGLSVNKSI SSRHRFMCQD       240
     IMEMRSKGWR ERRKQEGPKK IEDVHKDA                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page