(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE29

MICSR_1.PE29         Location/Qualifiers
FT   CDS             49931..51466
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636034"
FT                   /orf_name="MICPUN_56601"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO61598.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AB25"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q6"
FT                   /transl_table=1
FT                   /translation="MTTTSLAAGAVAVPRAMRVGARVSRRRSIARRRTLTTPRAGFLDD
FT                   MGVGDLGTSSPSSSAPVELANSIGSAVGRTYTELFPDLPSEVLGVSVPDTARALADAAR
FT                   PATDAAFQTLPDDAKSGLSDWWQREVDSGFTLVTGNAEYELALALLVFLWATGRPGVFG
FT                   GAFDAYFANAFDAVLLNKKFDKDSIKIRGKLGDGSFGSVSYAEDTDTGRELVVKQAKSV
FT                   QGAAQLQNAEEYMNRRVRRAPLVASGCAKYLGSYEVVEGASSPTLVWAFEGDVTLEELI
FT                   VRRDFPECVEELLYGGAQGGDDYAKRTSKVAKSVLRNLLSTLAGLHDIGIVHRDVKPAN
FT                   LVFMGRKFKLVDFGAAADLRTGKNYEPEQGLLDPFYSPPENFIMPERIPAPPPLRPLTA
FT                   SLSPLVWGTFLPDLFDSFSAGLVFLQMCVPQLRGRKVMDPNGSFRRLLEENNYDLRKWR
FT                   KVVEPQGWDFSALDANLGLGWDLACRLVCKRNFLQRGRLGCNTALLHPFFWTP"
     MTTTSLAAGA VAVPRAMRVG ARVSRRRSIA RRRTLTTPRA GFLDDMGVGD LGTSSPSSSA        60
     PVELANSIGS AVGRTYTELF PDLPSEVLGV SVPDTARALA DAARPATDAA FQTLPDDAKS       120
     GLSDWWQREV DSGFTLVTGN AEYELALALL VFLWATGRPG VFGGAFDAYF ANAFDAVLLN       180
     KKFDKDSIKI RGKLGDGSFG SVSYAEDTDT GRELVVKQAK SVQGAAQLQN AEEYMNRRVR       240
     RAPLVASGCA KYLGSYEVVE GASSPTLVWA FEGDVTLEEL IVRRDFPECV EELLYGGAQG       300
     GDDYAKRTSK VAKSVLRNLL STLAGLHDIG IVHRDVKPAN LVFMGRKFKL VDFGAAADLR       360
     TGKNYEPEQG LLDPFYSPPE NFIMPERIPA PPPLRPLTAS LSPLVWGTFL PDLFDSFSAG       420
     LVFLQMCVPQ LRGRKVMDPN GSFRRLLEEN NYDLRKWRKV VEPQGWDFSA LDANLGLGWD       480
     LACRLVCKRN FLQRGRLGCN TALLHPFFWT P                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page