(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE290

MICSR_1.PE290        Location/Qualifiers
FT   CDS             join(573237..574382,574702..575210,575665..576526)
FT                   /codon_start=1
FT                   /gene_family="HOG000218327" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636920"
FT                   /orf_name="MICPUN_79594"
FT                   /product="Predicted protein"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /function="polyribonucleotide nucleotidyltransferase
FT                   activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="mRNA catabolic process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ACO61738.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004654"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006402"
FT                   /db_xref="HOGENOM:HBG382411"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199A5D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G7"
FT                   /transl_table=1
FT                   /translation="MRARAPRIGAARSAGVQPCPRVVAPNGRRRPVRCAAAGAPDDPYA
FT                   ALDRTPKTLTLRIGESEVTVETGRIGRQANGAVMVTEGETVIYATICAGRDVTADGGFV
FT                   PLTVNYQERYSAVGRTAGGYRKRDGGVRENETLIGRLVDRPLRPMIPKGWAYDTQILEW
FT                   VLSYDGARSTDALAITAASCAAAISDVPLKKPIAGVRVGLLPGETEPLINPTCEQMERS
FT                   RLDLVLAGTEDAVMMIEGFGDFLTTQEMLYAIEKGHEAVANACRDIDAWAKDVGRVKNE
FT                   AAVLVAPEGVDDAVRALVGAELAEAMAISVKQTRGAAVEGIRARAIESLAGGDDAKFTV
FT                   SAVRRPAQSLRFAFCALLLFSLFPPGPRAFSRPFVRLPPPALENDVRLACGRCESNALR
FT                   SMIRANGVRQDGRDTKTVRPITCSGGLLPRTHGSSLFTRGETQAIAAATLGGATDAQKV
FT                   DGLGNDKDRRFYLHYFFPPSSVGETGRVGAASRREVGHGNLAERALMPVIPPYDDFPFT
FT                   VRLESTITESNGSSSMATVCAGSLALQDAGVPITRKVAGIAMGLILGDESAGEAPVILT
FT                   DILGSEDALGDMDFKVAGDGDGISAFQMDIKVEGITLAVLREALESARVGLVHILGEMD
FT                   KADPAPAGRMSAYAPQVEVVEVPTKYIGKVIGKGGEQIKAICEQTKIDTIDINEEGVVT
FT                   LTGSFGCDMPKAVEIIRSLTVEPEVGKTYRNARVTKVLDFGAFVEILPGVEGLCHVSEL
FT                   DVTRVANVRDVVEEGQTIDVKLLETNERGQFKLSRRAVLLDEGGEKVRRELAEAKVAAG
FT                   GDDADDAPGRGRPPPKARRGRSRLRE"
     MRARAPRIGA ARSAGVQPCP RVVAPNGRRR PVRCAAAGAP DDPYAALDRT PKTLTLRIGE        60
     SEVTVETGRI GRQANGAVMV TEGETVIYAT ICAGRDVTAD GGFVPLTVNY QERYSAVGRT       120
     AGGYRKRDGG VRENETLIGR LVDRPLRPMI PKGWAYDTQI LEWVLSYDGA RSTDALAITA       180
     ASCAAAISDV PLKKPIAGVR VGLLPGETEP LINPTCEQME RSRLDLVLAG TEDAVMMIEG       240
     FGDFLTTQEM LYAIEKGHEA VANACRDIDA WAKDVGRVKN EAAVLVAPEG VDDAVRALVG       300
     AELAEAMAIS VKQTRGAAVE GIRARAIESL AGGDDAKFTV SAVRRPAQSL RFAFCALLLF       360
     SLFPPGPRAF SRPFVRLPPP ALENDVRLAC GRCESNALRS MIRANGVRQD GRDTKTVRPI       420
     TCSGGLLPRT HGSSLFTRGE TQAIAAATLG GATDAQKVDG LGNDKDRRFY LHYFFPPSSV       480
     GETGRVGAAS RREVGHGNLA ERALMPVIPP YDDFPFTVRL ESTITESNGS SSMATVCAGS       540
     LALQDAGVPI TRKVAGIAMG LILGDESAGE APVILTDILG SEDALGDMDF KVAGDGDGIS       600
     AFQMDIKVEG ITLAVLREAL ESARVGLVHI LGEMDKADPA PAGRMSAYAP QVEVVEVPTK       660
     YIGKVIGKGG EQIKAICEQT KIDTIDINEE GVVTLTGSFG CDMPKAVEII RSLTVEPEVG       720
     KTYRNARVTK VLDFGAFVEI LPGVEGLCHV SELDVTRVAN VRDVVEEGQT IDVKLLETNE       780
     RGQFKLSRRA VLLDEGGEKV RRELAEAKVA AGGDDADDAP GRGRPPPKAR RGRSRLRE         838
//

If you have problems or comments...

PBIL Back to PBIL home page