(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE291

MICSR_1.PE291        Location/Qualifiers
FT   CDS             complement(576679..580467)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636921"
FT                   /orf_name="MICPUN_56867"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62165.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199A64E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G8"
FT                   /transl_table=1
FT                   /translation="MAGSFEATLSVSDRPELTSLAVTAVPIDPPAVERAAAGDGTTDRR
FT                   DPEHGVGGKGKNNGNEEDASTGARPEKQRKSSEREESVSDDEDQPDDDGLHAAAKKGMN
FT                   VVGWWRAKLNANHGLDKEILAALHLLAGARGPCMRLAFSHPVLSQPGDSDARRRNKEGL
FT                   TKLHREMRAEQKSAVMFLDDPATGRRREVHLAAVWVHPADTAGDTAGDAVGSNGADEAA
FT                   LTTNDEAAPTTNDDGDKADAREPQFLAFEVQPNAPAVALEPLLHKQLMVVFDLDETLLQ
FT                   AFTLRAMERRARELDAEDAGADGGADGGADGGADDAATSGWGGGGRGDPGKNTAGVPGA
FT                   VGGDARAATRDAKELAARRDEDRRRLRRDAELLTQFRDGDCVKMPVPGSATGTTQTVRA
FT                   KMEPVLVLDEERYGPSPVTVARPVIRVKSPHVRGGEMVFTRIDPKNVDTSMIVHVRPGW
FT                   NDLYAYLTGEASQAQAPNAVRGVNKENPAHRPRRPKCKAFVCTMSERQYAHEMWRLLDP
FT                   RGALLPLNDVHALHKRIVCVEHGRGEKKSLAHATRGATHVPELSVIVDDRTNVWERRAQ
FT                   KNILAIAPFMPYNTDTGPGLQSEVAGKGGVMGMVQSMLNEVRFKFSQQWTRWAQRCDRG
FT                   DPLRPGGERPDAGEILAPLMASWAEDNTATIVRQGGAARAAAGAGSSLNAVLKSLGRSK
FT                   SNAEEAQRRRDAEAKAKAEEEERAKAEEERAREEERVREEEKQRRWLEEAQAKLKEEER
FT                   ARAEEQRRLLQETEAKVEEQRRLLQETEAKFKEQTRLLKEAEAKVNRARMDDALAAITY
FT                   ESLAATPLEAKGKRPVKAKTEVKTATAGDVDGLGTDSDDSDDAPIAAMAAEPKRPTAED
FT                   EKRRSDEEAKRKKQVRNCQQCSQWGIRAVDHFKSCKMCPFHKDYVHPKHDDDARRRLFE
FT                   RLVELRWSSSAEKAIEGATRLVEKFQPTAIKDGNIEVGELEDAVATRLLRFVLTRQGNP
FT                   AAAPPAAAAPPAAAATLAAAAPAEESEGKSVKKPEPKKRKSGEISKQPKGGGKEAPLLG
FT                   VADGYVKKHKSLKEIIEMKEKSEVVEIEEEQEEEEEEEEIDHGPCVLCGIKDQNEMLCD
FT                   GCDRPFHNSCVNISDEELEIMIEAEEDWFCEDCVKSGKNAGANDEMREHKLKKMDKADS
FT                   DFNLDARDEVEFIKGTRGNPGAASRVRQEKKKASGQAPGPAPAEGAREVHPKDEETGET
FT                   EELAPKPSPSKSVASKYKPGTQREAMMKKLKKIGKRR"
     MAGSFEATLS VSDRPELTSL AVTAVPIDPP AVERAAAGDG TTDRRDPEHG VGGKGKNNGN        60
     EEDASTGARP EKQRKSSERE ESVSDDEDQP DDDGLHAAAK KGMNVVGWWR AKLNANHGLD       120
     KEILAALHLL AGARGPCMRL AFSHPVLSQP GDSDARRRNK EGLTKLHREM RAEQKSAVMF       180
     LDDPATGRRR EVHLAAVWVH PADTAGDTAG DAVGSNGADE AALTTNDEAA PTTNDDGDKA       240
     DAREPQFLAF EVQPNAPAVA LEPLLHKQLM VVFDLDETLL QAFTLRAMER RARELDAEDA       300
     GADGGADGGA DGGADDAATS GWGGGGRGDP GKNTAGVPGA VGGDARAATR DAKELAARRD       360
     EDRRRLRRDA ELLTQFRDGD CVKMPVPGSA TGTTQTVRAK MEPVLVLDEE RYGPSPVTVA       420
     RPVIRVKSPH VRGGEMVFTR IDPKNVDTSM IVHVRPGWND LYAYLTGEAS QAQAPNAVRG       480
     VNKENPAHRP RRPKCKAFVC TMSERQYAHE MWRLLDPRGA LLPLNDVHAL HKRIVCVEHG       540
     RGEKKSLAHA TRGATHVPEL SVIVDDRTNV WERRAQKNIL AIAPFMPYNT DTGPGLQSEV       600
     AGKGGVMGMV QSMLNEVRFK FSQQWTRWAQ RCDRGDPLRP GGERPDAGEI LAPLMASWAE       660
     DNTATIVRQG GAARAAAGAG SSLNAVLKSL GRSKSNAEEA QRRRDAEAKA KAEEEERAKA       720
     EEERAREEER VREEEKQRRW LEEAQAKLKE EERARAEEQR RLLQETEAKV EEQRRLLQET       780
     EAKFKEQTRL LKEAEAKVNR ARMDDALAAI TYESLAATPL EAKGKRPVKA KTEVKTATAG       840
     DVDGLGTDSD DSDDAPIAAM AAEPKRPTAE DEKRRSDEEA KRKKQVRNCQ QCSQWGIRAV       900
     DHFKSCKMCP FHKDYVHPKH DDDARRRLFE RLVELRWSSS AEKAIEGATR LVEKFQPTAI       960
     KDGNIEVGEL EDAVATRLLR FVLTRQGNPA AAPPAAAAPP AAAATLAAAA PAEESEGKSV      1020
     KKPEPKKRKS GEISKQPKGG GKEAPLLGVA DGYVKKHKSL KEIIEMKEKS EVVEIEEEQE      1080
     EEEEEEEIDH GPCVLCGIKD QNEMLCDGCD RPFHNSCVNI SDEELEIMIE AEEDWFCEDC      1140
     VKSGKNAGAN DEMREHKLKK MDKADSDFNL DARDEVEFIK GTRGNPGAAS RVRQEKKKAS      1200
     GQAPGPAPAE GAREVHPKDE ETGETEELAP KPSPSKSVAS KYKPGTQREA MMKKLKKIGK      1260
     RR                                                                     1262
//

If you have problems or comments...

PBIL Back to PBIL home page