(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE292

MICSR_1.PE292        Location/Qualifiers
FT   CDS             580947..582185
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636922"
FT                   /orf_name="MICPUN_99418"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61739.1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199A64F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G9"
FT                   /transl_table=1
FT                   /translation="MSIASGVASVPVGVPHATPRRGGPRNATAKPHIPRRPRLDAPSAW
FT                   AETSPSAPSSASSATASDARDDLPVRVYIEHTDAYQVVYHSNYFKFLWRAREAYVFGGG
FT                   LASALRHRTGAPFDPTAAGWDHLDVVAIDDCVFARSAVLGDDLLVRTSLRGIGETTLAM
FT                   RQEVVFADGGELAFAATAVVAPASATGATTIPREIRGWRAGDEDGIDGVDVGTGYEDPA
FT                   WLARASASASVEDAGDCSEDDEEANEDPEARVSSIATKTRVTLFESELSLGRARGASDA
FT                   DVLRWFERDRTEAIGGSSALSALKENDGVAVVVSSMDGFRCRPGNVVGSAGIGAGGASG
FT                   GRNVRPAVASARSTIEMRRRNIQVAFIQRLFDEAGACVARAEVVCTCVTRDGGKPTRCP
FT                   AALAEKFEAMRRG"
     MSIASGVASV PVGVPHATPR RGGPRNATAK PHIPRRPRLD APSAWAETSP SAPSSASSAT        60
     ASDARDDLPV RVYIEHTDAY QVVYHSNYFK FLWRAREAYV FGGGLASALR HRTGAPFDPT       120
     AAGWDHLDVV AIDDCVFARS AVLGDDLLVR TSLRGIGETT LAMRQEVVFA DGGELAFAAT       180
     AVVAPASATG ATTIPREIRG WRAGDEDGID GVDVGTGYED PAWLARASAS ASVEDAGDCS       240
     EDDEEANEDP EARVSSIATK TRVTLFESEL SLGRARGASD ADVLRWFERD RTEAIGGSSA       300
     LSALKENDGV AVVVSSMDGF RCRPGNVVGS AGIGAGGASG GRNVRPAVAS ARSTIEMRRR       360
     NIQVAFIQRL FDEAGACVAR AEVVCTCVTR DGGKPTRCPA ALAEKFEAMR RG               412
//

If you have problems or comments...

PBIL Back to PBIL home page