(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE293

MICSR_1.PE293        Location/Qualifiers
FT   CDS             583818..585401
FT                   /codon_start=1
FT                   /gene_family="HOG000222134" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636923"
FT                   /orf_name="MICPUN_79438"
FT                   /product="Predicted protein"
FT                   /function="glycerol kinase activity"
FT                   /biological_process="glycerol-3-phosphate metabolic process"
FT                   /protein_id="ACO61740.1"
FT                   /db_xref="GO:0004370"
FT                   /db_xref="GO:0006072"
FT                   /db_xref="HOGENOM:HBG511469"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI000199A650"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H0"
FT                   /transl_table=1
FT                   /translation="MAPKLVGAIDQGTTSTRFILYRVVGDGVLQPLASHQMEHKQIYPK
FT                   PGWCEHDPEEIYANTLTCIASALEAVPGGATASDVACVGITNQRETTVAWSKRTGKPLH
FT                   NAVVWLDMRTSDLCESLTSEVMGGDKDAFREVCGLPISTYFSGVKMRWLLDNCDAVKAA
FT                   AAENDLAFGTIDSWLLHRLTGSAGTHVTDATNASRTMLMDLRTQTWHEPTAVKLGVPMH
FT                   SLPRIVSCAEEYGVITEGALKGVKLTGCLGDQHAATLGQRCDAGRAKNTYGTGCFMLLN
FT                   TGGNVVESKHGLLTTMAWRLGKDATPAYALEGSVAIAGAGVQWLRDNLGLIRSAADVEP
FT                   LAASVPDAGGVYFVPAFSGLFAPRWRPDARGVCVGLTQFTTKAHLARALLEAICFQTVD
FT                   VLEAMRKDASDLDMTALHVDGGATANGLMMQTQADLLGLRVFRPANVETTAMGAALAAG
FT                   VGAGLFSERAVFEDTPADESIADAEWLRDEMANRAYFEPAIGEDERARRYAGWCDAVER
FT                   SLNLAPQQGK"
     MAPKLVGAID QGTTSTRFIL YRVVGDGVLQ PLASHQMEHK QIYPKPGWCE HDPEEIYANT        60
     LTCIASALEA VPGGATASDV ACVGITNQRE TTVAWSKRTG KPLHNAVVWL DMRTSDLCES       120
     LTSEVMGGDK DAFREVCGLP ISTYFSGVKM RWLLDNCDAV KAAAAENDLA FGTIDSWLLH       180
     RLTGSAGTHV TDATNASRTM LMDLRTQTWH EPTAVKLGVP MHSLPRIVSC AEEYGVITEG       240
     ALKGVKLTGC LGDQHAATLG QRCDAGRAKN TYGTGCFMLL NTGGNVVESK HGLLTTMAWR       300
     LGKDATPAYA LEGSVAIAGA GVQWLRDNLG LIRSAADVEP LAASVPDAGG VYFVPAFSGL       360
     FAPRWRPDAR GVCVGLTQFT TKAHLARALL EAICFQTVDV LEAMRKDASD LDMTALHVDG       420
     GATANGLMMQ TQADLLGLRV FRPANVETTA MGAALAAGVG AGLFSERAVF EDTPADESIA       480
     DAEWLRDEMA NRAYFEPAIG EDERARRYAG WCDAVERSLN LAPQQGK                     527
//

If you have problems or comments...

PBIL Back to PBIL home page