(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE295

MICSR_1.PE295        Location/Qualifiers
FT   CDS             588253..589380
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636925"
FT                   /orf_name="MICPUN_56871"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61741.1"
FT                   /db_xref="UniParc:UPI000199A652"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H2"
FT                   /transl_table=1
FT                   /translation="MLAWIGARKNRAHRGGASTLAARYDLAVRASTSARGAKHERDEDQ
FT                   LACEDEELRPSVRRKASAALASSKPAATSLDVLDLHVLCHLMECERESSREKDKDDEAR
FT                   AALKPAEASRRASRSPCVKRAREESGDGDDDMELALEGLALSPSPPSPFGPTQGRPHTA
FT                   SSPCSPPEQLRTPGAFTLPSPPRKKIKPGLAPSLAPFASSPGRSWTTLGLDAGLGSILG
FT                   ARRTRPKACRSLDFSLPTLSESAGAERGTQLSSQDEGSFDEKDAIDVVMSHKYGRPEDV
FT                   MDADETDDAAADDDEEADATDAMEEDAENRRLRAVSLVDVDTRGGGVRQSARVDRGALM
FT                   EVMSAVGGGRTNASIGAVPWRVMKLMQIEEEIFII"
     MLAWIGARKN RAHRGGASTL AARYDLAVRA STSARGAKHE RDEDQLACED EELRPSVRRK        60
     ASAALASSKP AATSLDVLDL HVLCHLMECE RESSREKDKD DEARAALKPA EASRRASRSP       120
     CVKRAREESG DGDDDMELAL EGLALSPSPP SPFGPTQGRP HTASSPCSPP EQLRTPGAFT       180
     LPSPPRKKIK PGLAPSLAPF ASSPGRSWTT LGLDAGLGSI LGARRTRPKA CRSLDFSLPT       240
     LSESAGAERG TQLSSQDEGS FDEKDAIDVV MSHKYGRPED VMDADETDDA AADDDEEADA       300
     TDAMEEDAEN RRLRAVSLVD VDTRGGGVRQ SARVDRGALM EVMSAVGGGR TNASIGAVPW       360
     RVMKLMQIEE EIFII                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page