(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE296

MICSR_1.PE296        Location/Qualifiers
FT   CDS             complement(589574..590731)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636926"
FT                   /orf_name="MICPUN_56872"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62167.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR022143"
FT                   /db_xref="UniParc:UPI000199A653"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H3"
FT                   /transl_table=1
FT                   /translation="MAEREPPSSPPGYVPGDSDSESPDIATRRRDPPPGPVVESVSPGE
FT                   RARGRGDSGEEGRDLDDYDNSGGGSGDPATPGTISFRSGLELIHNVKEGSECRICLMDH
FT                   TPFCKPCRCQGTMGHVHPECLARWCRETGVTKCELCHSTFPQYFIDAGKRTRRVREREQ
FT                   ADAQEASERLAAQTANFQVAYGRPPTTAMDYAVINLNSMLEAEAAMRQRQRENNGVEDR
FT                   QFNESMRVVVIDSSGRPQAVSMGELRGASGGGGGLGLQPVGDQNYDLDRAIVNHQLSFW
FT                   ARIVVSTLCVFLVLYIIVAIVAASSDAGRDSYPVFIFRLLGFMLPLLLIARAVYVFRRR
FT                   REQAMINTVNDMFIRHHAQTAEVRPAAGGGNGAREQRGTRRLLDV"
     MAEREPPSSP PGYVPGDSDS ESPDIATRRR DPPPGPVVES VSPGERARGR GDSGEEGRDL        60
     DDYDNSGGGS GDPATPGTIS FRSGLELIHN VKEGSECRIC LMDHTPFCKP CRCQGTMGHV       120
     HPECLARWCR ETGVTKCELC HSTFPQYFID AGKRTRRVRE REQADAQEAS ERLAAQTANF       180
     QVAYGRPPTT AMDYAVINLN SMLEAEAAMR QRQRENNGVE DRQFNESMRV VVIDSSGRPQ       240
     AVSMGELRGA SGGGGGLGLQ PVGDQNYDLD RAIVNHQLSF WARIVVSTLC VFLVLYIIVA       300
     IVAASSDAGR DSYPVFIFRL LGFMLPLLLI ARAVYVFRRR REQAMINTVN DMFIRHHAQT       360
     AEVRPAAGGG NGAREQRGTR RLLDV                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page