(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE297

MICSR_1.PE297        Location/Qualifiers
FT   CDS             join(591004..591053,591270..591425,591582..594900)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636927"
FT                   /orf_name="MICPUN_99422"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO61742.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020478"
FT                   /db_xref="UniParc:UPI000199A654"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H4"
FT                   /transl_table=1
FT                   /translation="MPLVRSNDAPDSADPVRSGAIFGLVPSTGAPPHDAHPGSPGGGFG
FT                   GSPYGGGGSYGGDTRETQQYTDYQNMGNGWVQRTRRSTVERVIERVHTDVDEMVPMRGG
FT                   AGGAHLHGGGGGGLVPHGGPGSNGWLNGELARQVHSKFEDMVRQSPAPTRAERSAYDEL
FT                   VRSFPPPESRGRLALGDGSGIEREPQPGIVSPTGGYAAPWMNGGGGGGGAGGDGRYPSR
FT                   LGHNTAGDGDNTAGGVDANGSPAERSIFSDLKSPPPSMRRASGGGGSGSGFTLDDLILR
FT                   KKGPDAAAARGAIFSPPPSPPGGRGRGRGRRGRKPGAGAGAKKPSPPPEPSESSSESED
FT                   ADEDADDDYVSPAGVEGGRDASSPLEKLARAAEKRGATRAGASPRVTVGKSPAKSPASL
FT                   TARAARRSYRIGDSDSDDDGNKIAAVRAGRTKPSTGVGGNKRGSREARQLLIAAQRMAR
FT                   VTGGGGAGASGVVATATTPAAASPSALRGAGTPASVGGRSGGRSTRERRAPSAFWLNED
FT                   AKRKDPFATTATPAATSAAAESKKTAARAKPGPKAKKPAAKRGRPKSKAKPAAKRRRDD
FT                   DDDDDDDDGESSSSESESESESEESEEEETLEARAARTSAVKKSVAKKSAVKSPAKRPR
FT                   GRSPTKGPTRARPAKKPSKSLAVYSESEDATDEDEDEEDEEDEDEEDEDDDVPPPKGDD
FT                   DTEESDGDDTEESDEDSEDDTPLASRYKGKPSKAAASPKGKKPPPAAKPKPKPSPKPAK
FT                   PSPGKGNRRHSAEHAAALVSAEIMGRKTSMARRFGLNVARVVDSEAESSDDDEEEGEDD
FT                   DDAGPPGSTPTDRSSDRTEASSPATATTDADGGAADTTDADDTPATKGSAGGQPPRSIE
FT                   KGKRGGWRPGAGRPRKVYDPNDPTPRKRRRLPGEPPRKRGRPRKHPTAEDIEAGHIRRK
FT                   PASAEEKAAALRRLAGGIGGIFGQDVAAPKPRGRPRKDGSSKSAPPKPSGADNKPARET
FT                   PAPAVRANAISTERWAARVKKAFAGGNAEASHPDSPPRRREVSFPENEGEGAAGAEPRD
FT                   GAASAPRSAPPAPPPSGRYGSDRENEQVSAAKSSRRKSILRTLGKSLGEENERDARRNA
FT                   LDRRYSDVPEFEVFGFQGTPEKGGAASPDFGGSPGLFTAKSPGGLISQLDTDTPVTSPV
FT                   RSSPRLRG"
     MPLVRSNDAP DSADPVRSGA IFGLVPSTGA PPHDAHPGSP GGGFGGSPYG GGGSYGGDTR        60
     ETQQYTDYQN MGNGWVQRTR RSTVERVIER VHTDVDEMVP MRGGAGGAHL HGGGGGGLVP       120
     HGGPGSNGWL NGELARQVHS KFEDMVRQSP APTRAERSAY DELVRSFPPP ESRGRLALGD       180
     GSGIEREPQP GIVSPTGGYA APWMNGGGGG GGAGGDGRYP SRLGHNTAGD GDNTAGGVDA       240
     NGSPAERSIF SDLKSPPPSM RRASGGGGSG SGFTLDDLIL RKKGPDAAAA RGAIFSPPPS       300
     PPGGRGRGRG RRGRKPGAGA GAKKPSPPPE PSESSSESED ADEDADDDYV SPAGVEGGRD       360
     ASSPLEKLAR AAEKRGATRA GASPRVTVGK SPAKSPASLT ARAARRSYRI GDSDSDDDGN       420
     KIAAVRAGRT KPSTGVGGNK RGSREARQLL IAAQRMARVT GGGGAGASGV VATATTPAAA       480
     SPSALRGAGT PASVGGRSGG RSTRERRAPS AFWLNEDAKR KDPFATTATP AATSAAAESK       540
     KTAARAKPGP KAKKPAAKRG RPKSKAKPAA KRRRDDDDDD DDDDGESSSS ESESESESEE       600
     SEEEETLEAR AARTSAVKKS VAKKSAVKSP AKRPRGRSPT KGPTRARPAK KPSKSLAVYS       660
     ESEDATDEDE DEEDEEDEDE EDEDDDVPPP KGDDDTEESD GDDTEESDED SEDDTPLASR       720
     YKGKPSKAAA SPKGKKPPPA AKPKPKPSPK PAKPSPGKGN RRHSAEHAAA LVSAEIMGRK       780
     TSMARRFGLN VARVVDSEAE SSDDDEEEGE DDDDAGPPGS TPTDRSSDRT EASSPATATT       840
     DADGGAADTT DADDTPATKG SAGGQPPRSI EKGKRGGWRP GAGRPRKVYD PNDPTPRKRR       900
     RLPGEPPRKR GRPRKHPTAE DIEAGHIRRK PASAEEKAAA LRRLAGGIGG IFGQDVAAPK       960
     PRGRPRKDGS SKSAPPKPSG ADNKPARETP APAVRANAIS TERWAARVKK AFAGGNAEAS      1020
     HPDSPPRRRE VSFPENEGEG AAGAEPRDGA ASAPRSAPPA PPPSGRYGSD RENEQVSAAK      1080
     SSRRKSILRT LGKSLGEENE RDARRNALDR RYSDVPEFEV FGFQGTPEKG GAASPDFGGS      1140
     PGLFTAKSPG GLISQLDTDT PVTSPVRSSP RLRG                                  1174
//

If you have problems or comments...

PBIL Back to PBIL home page