(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE298

MICSR_1.PE298        Location/Qualifiers
FT   CDS             complement(595008..596393)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636928"
FT                   /orf_name="MICPUN_56875"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62168.1"
FT                   /db_xref="UniParc:UPI000199A655"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H5"
FT                   /transl_table=1
FT                   /translation="MARRADVLLASVLGVAVTLTLASLVVDATDARAREPRDPAEKPGA
FT                   SPCWARSPTNASRLVPKEGGCDGFDADEVGGVDRARKLDECACVYAQAVCDVQPGLVCS
FT                   VPDGRYVCRDEATGAVGGTAGQELRVPCLQSLCTSVTCPLDPRTLPLGDDGASAAKVCD
FT                   VCEMYGYAAGTGELRAQEGSRCGGEVRAQGLRFGPKAALLAYSAFMFVDFTMAAAAAGK
FT                   PLPQDLPTTSQYPEYHHGQPSAPVLLPEILEQDTGGDWQTTTTAYEYPPTTTTYEYPPT
FT                   PPTPPSPSQHPSRPPPLPSLCDVDDLMDVLPSALPSLVPCLSGSTSTCCQNVANIVGES
FT                   TDADMTDCLCNRDAFDALAGLLMDNVGLDLASRLGECVAKGYRINFPADEGGGGGCDRY
FT                   EKRETRAYVRPRTERKGVEESGDPDAVARDRPRASVTAQSRARNAAGPRAGSDEAPARG
FT                   DDR"
     MARRADVLLA SVLGVAVTLT LASLVVDATD ARAREPRDPA EKPGASPCWA RSPTNASRLV        60
     PKEGGCDGFD ADEVGGVDRA RKLDECACVY AQAVCDVQPG LVCSVPDGRY VCRDEATGAV       120
     GGTAGQELRV PCLQSLCTSV TCPLDPRTLP LGDDGASAAK VCDVCEMYGY AAGTGELRAQ       180
     EGSRCGGEVR AQGLRFGPKA ALLAYSAFMF VDFTMAAAAA GKPLPQDLPT TSQYPEYHHG       240
     QPSAPVLLPE ILEQDTGGDW QTTTTAYEYP PTTTTYEYPP TPPTPPSPSQ HPSRPPPLPS       300
     LCDVDDLMDV LPSALPSLVP CLSGSTSTCC QNVANIVGES TDADMTDCLC NRDAFDALAG       360
     LLMDNVGLDL ASRLGECVAK GYRINFPADE GGGGGCDRYE KRETRAYVRP RTERKGVEES       420
     GDPDAVARDR PRASVTAQSR ARNAAGPRAG SDEAPARGDD R                           461
//

If you have problems or comments...

PBIL Back to PBIL home page