(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE3

MICSR_1.PE3          Location/Qualifiers
FT   CDS             complement(9334..13197)
FT                   /codon_start=1
FT                   /gene_family="HOG000231203" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636008"
FT                   /orf_name="MICPUN_56574"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62030.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG505899"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022577"
FT                   /db_xref="UniParc:UPI000199AA4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N0"
FT                   /transl_table=1
FT                   /translation="MDPPTEEGFDDENELTFVKEAPEVNGLVEQIKDALEGRDPADGTS
FT                   TISKTVFHKIQEIVERYQEYPTLLDPHLEGWILPLTSVIRREAHKGSEADMVLVQRASR
FT                   VLHALASVRGYKTVVKFFPHEAKDFEPVVALLVRSHDVGSLATNMEEADELGSAWETRA
FT                   TLILWLSILVLIPFDLVTVDSQVTTNTGVDGAAMAKSGGQQEAPPVVLRILALCQDSYL
FT                   RDPGIVRDRAAFLLAKLLTRPDMPLALQKFLVWATDALGGQSEYSEQEKMFIVPGIVRA
FT                   LAATFKLGKRSELLEVAERLWTNARDLADSPAAKASTLTRKLACKLTQRIGLLFLKPRV
FT                   VSWRYERGARSLEDNLKRAMIISQGGDADAEDRKKAEEAAAKEQEEDEDWDIPEEIEEV
FT                   IEALLTALRDKDTVVRWSAAKGLGRITARLPAELGDEVVGSILDCFLPTENDNTWHGAC
FT                   LALAELSRRGLLLPVRLPDAVPHVASALAYDVRRGPHSVGAHVRDAASYVCWAFARAYA
FT                   PEVLAPHADALAPSLLIAACFDREVNCRRAASAAFQESVGRLGAFPHGIDIIQVADYFS
FT                   LGSRTKAYTVVADHICGYDEYRRRMLNHLCDVKLIHWERATRELAARTISIIGRRDPEW
FT                   IREVALPVLLDRSLSTNLEARHGACVGAAEALLALKNAGEPCVEGELATKVTGLVTAIE
FT                   KARLYRGKGGEVMRAAVSKYVQCLASVSQPLDKGPGPATGPKSLRSTLLASLEENLKHP
FT                   TVDIRDSAVSAMEEFSASYMVGSNPAAGAKRLIVKLATLLREDQNPAARRGAALALGVM
FT                   PGEMLFSCVPGFAAEAPAEENVDAEADPEMIPAWRMALEALKAASIPEEDVEARDADAR
FT                   VCATKGMAGVLSRMATNLVEDDYAATSQAASEVISSLLTCMEDYCTDNRGDVGSWVREA
FT                   AMEALPGAISALQASGLELATGRCATIVSALLKQCAEKIDRTRASAATALCAVLRGRES
FT                   DMLEPLPDVPGLNKLLDAAPTEERLAASWAVPTSAYAALTPLIVADGSDPLAAYRADLI
FT                   EGIVVSAGGVGDSLGKASGGALVAAVKADPALQETVANELVDLLSRRQGVDRVTVPLLR
FT                   VLDLLFSSGALASVAPAHPDPPNAFAHTLAENLRAELKGSRDVAKLCHGVQALSHVAAL
FT                   GPNVINSDRCARTSGLQGILALMVSRYPRVRRVASEALYVLLLGLDEEAAGEGIEAAIE
FT                   LLSDTRWDAELTMVKPERNKLYPLLGLEAPAAALEAAKGPGVKVKVVDENESYAALVGS
FT                   AGY"
     MDPPTEEGFD DENELTFVKE APEVNGLVEQ IKDALEGRDP ADGTSTISKT VFHKIQEIVE        60
     RYQEYPTLLD PHLEGWILPL TSVIRREAHK GSEADMVLVQ RASRVLHALA SVRGYKTVVK       120
     FFPHEAKDFE PVVALLVRSH DVGSLATNME EADELGSAWE TRATLILWLS ILVLIPFDLV       180
     TVDSQVTTNT GVDGAAMAKS GGQQEAPPVV LRILALCQDS YLRDPGIVRD RAAFLLAKLL       240
     TRPDMPLALQ KFLVWATDAL GGQSEYSEQE KMFIVPGIVR ALAATFKLGK RSELLEVAER       300
     LWTNARDLAD SPAAKASTLT RKLACKLTQR IGLLFLKPRV VSWRYERGAR SLEDNLKRAM       360
     IISQGGDADA EDRKKAEEAA AKEQEEDEDW DIPEEIEEVI EALLTALRDK DTVVRWSAAK       420
     GLGRITARLP AELGDEVVGS ILDCFLPTEN DNTWHGACLA LAELSRRGLL LPVRLPDAVP       480
     HVASALAYDV RRGPHSVGAH VRDAASYVCW AFARAYAPEV LAPHADALAP SLLIAACFDR       540
     EVNCRRAASA AFQESVGRLG AFPHGIDIIQ VADYFSLGSR TKAYTVVADH ICGYDEYRRR       600
     MLNHLCDVKL IHWERATREL AARTISIIGR RDPEWIREVA LPVLLDRSLS TNLEARHGAC       660
     VGAAEALLAL KNAGEPCVEG ELATKVTGLV TAIEKARLYR GKGGEVMRAA VSKYVQCLAS       720
     VSQPLDKGPG PATGPKSLRS TLLASLEENL KHPTVDIRDS AVSAMEEFSA SYMVGSNPAA       780
     GAKRLIVKLA TLLREDQNPA ARRGAALALG VMPGEMLFSC VPGFAAEAPA EENVDAEADP       840
     EMIPAWRMAL EALKAASIPE EDVEARDADA RVCATKGMAG VLSRMATNLV EDDYAATSQA       900
     ASEVISSLLT CMEDYCTDNR GDVGSWVREA AMEALPGAIS ALQASGLELA TGRCATIVSA       960
     LLKQCAEKID RTRASAATAL CAVLRGRESD MLEPLPDVPG LNKLLDAAPT EERLAASWAV      1020
     PTSAYAALTP LIVADGSDPL AAYRADLIEG IVVSAGGVGD SLGKASGGAL VAAVKADPAL      1080
     QETVANELVD LLSRRQGVDR VTVPLLRVLD LLFSSGALAS VAPAHPDPPN AFAHTLAENL      1140
     RAELKGSRDV AKLCHGVQAL SHVAALGPNV INSDRCARTS GLQGILALMV SRYPRVRRVA      1200
     SEALYVLLLG LDEEAAGEGI EAAIELLSDT RWDAELTMVK PERNKLYPLL GLEAPAAALE      1260
     AAKGPGVKVK VVDENESYAA LVGSAGY                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page