(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE30

MICSR_1.PE30         Location/Qualifiers
FT   CDS             complement(51506..52540)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636035"
FT                   /orf_name="MICPUN_107850"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62044.1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000199AB26"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q7"
FT                   /transl_table=1
FT                   /translation="MAYISVVLNDWKYSCPIVWSFYSTALAAGRENGKLRREVEQNLRL
FT                   KYSKELPPPNTSSEPPSEKSMKSGIKSGMKGVAKGMTDVAKVTSGGLTYLLFGGKDDMS
FT                   NEMREELEVELDKIRRSRRARTRWFLALTLMNNPSLIAMRRPWGGQPQNVAMLKPSHLP
FT                   HAVKKGWLRRRGGILGVVNDDYVMLTPGVLYIFEHDLARNPKVYTLSSRVLVRRLFVSV
FT                   RDQTSGGWHFGGDRYEPGPDEVDPPDAEDGLRLPSKKIDDKEKGNKKKDDKDKGGDGDP
FT                   AKSAESSKWKLREKHFFVISIPGGPMEVFASADLDDVTDWVGALRASCLGAPDRSMLAG
FT                   LKQD"
     MAYISVVLND WKYSCPIVWS FYSTALAAGR ENGKLRREVE QNLRLKYSKE LPPPNTSSEP        60
     PSEKSMKSGI KSGMKGVAKG MTDVAKVTSG GLTYLLFGGK DDMSNEMREE LEVELDKIRR       120
     SRRARTRWFL ALTLMNNPSL IAMRRPWGGQ PQNVAMLKPS HLPHAVKKGW LRRRGGILGV       180
     VNDDYVMLTP GVLYIFEHDL ARNPKVYTLS SRVLVRRLFV SVRDQTSGGW HFGGDRYEPG       240
     PDEVDPPDAE DGLRLPSKKI DDKEKGNKKK DDKDKGGDGD PAKSAESSKW KLREKHFFVI       300
     SIPGGPMEVF ASADLDDVTD WVGALRASCL GAPDRSMLAG LKQD                        344
//

If you have problems or comments...

PBIL Back to PBIL home page