(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE300

MICSR_1.PE300        Location/Qualifiers
FT   CDS             complement(598588..600120)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636930"
FT                   /orf_name="MICPUN_56877"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62169.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A657"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H7"
FT                   /transl_table=1
FT                   /translation="MAPDVSARIRAGHDASPRTPDAIKRPDGPAESSLAGPLRRAVLDD
FT                   RAAEVRALMKFRSVSENRAPDGDCTAADALLLAIERGSFASTVELVKMRATPLDAACLL
FT                   AAAASPNPECAAFVIDGCTAAGVSPDSRDHSGRTPLEIATRHRADLTAPHERSPTSHFS
FT                   PAHRHGDDGGAGAVASSLLRCGAGANVEFSDGATPLIAAARAGRHTVAAALLAHGADPL
FT                   AVDRSRSMDAVAGGTALHAAAMSGHAECVRVIVDVLRAIMEDDEASAGAFKGANGGDGH
FT                   MNCLNPFAAFSRIFSSLGPAPPSPGLKGTDWSELTGEDDEKNGGAGSSVAAPSSPVMGS
FT                   DDDDDEKDEKDGERKPSLLDAGDSIGRSALLLAIAGGNIAAASVLCDAGADRRQRVGDR
FT                   TLLHVAVERDEPEICEILLRRRDSLTPRALYRSDSFGGGGVGPFGTGVGRGALAGPPAE
FT                   VDARDSGGRTALMLAAEARKSQCAEVLADRGADQDAAPGLRRKVETLLNVYI"
     MAPDVSARIR AGHDASPRTP DAIKRPDGPA ESSLAGPLRR AVLDDRAAEV RALMKFRSVS        60
     ENRAPDGDCT AADALLLAIE RGSFASTVEL VKMRATPLDA ACLLAAAASP NPECAAFVID       120
     GCTAAGVSPD SRDHSGRTPL EIATRHRADL TAPHERSPTS HFSPAHRHGD DGGAGAVASS       180
     LLRCGAGANV EFSDGATPLI AAARAGRHTV AAALLAHGAD PLAVDRSRSM DAVAGGTALH       240
     AAAMSGHAEC VRVIVDVLRA IMEDDEASAG AFKGANGGDG HMNCLNPFAA FSRIFSSLGP       300
     APPSPGLKGT DWSELTGEDD EKNGGAGSSV AAPSSPVMGS DDDDDEKDEK DGERKPSLLD       360
     AGDSIGRSAL LLAIAGGNIA AASVLCDAGA DRRQRVGDRT LLHVAVERDE PEICEILLRR       420
     RDSLTPRALY RSDSFGGGGV GPFGTGVGRG ALAGPPAEVD ARDSGGRTAL MLAAEARKSQ       480
     CAEVLADRGA DQDAAPGLRR KVETLLNVYI                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page