(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE302

MICSR_1.PE302        Location/Qualifiers
FT   CDS             join(complement(601933..602154),complement(601606..601755))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636932"
FT                   /orf_name="MICPUN_56879"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO62170.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG734125"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="UniParc:UPI000199A6C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H9"
FT                   /transl_table=1
FT                   /translation="MASFVMSASAVKAPAVKVSGLGFRKAVSAVAMPKAAAKPVQAHAA
FT                   FSVVCGKPGAKAKTNKSAAKRFKITASGKVLHRRPGKQHLNGHKTTERKTRLSGERQIG
FT                   AEQIPLVKGLLPYSRKRIR"
     MASFVMSASA VKAPAVKVSG LGFRKAVSAV AMPKAAAKPV QAHAAFSVVC GKPGAKAKTN        60
     KSAAKRFKIT ASGKVLHRRP GKQHLNGHKT TERKTRLSGE RQIGAEQIPL VKGLLPYSRK       120
     RIR                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page