(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE303

MICSR_1.PE303        Location/Qualifiers
FT   CDS             <602704..>603614
FT                   /codon_start=1
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636933"
FT                   /orf_name="MICPUN_75681"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO61745.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199A6C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I0"
FT                   /transl_table=1
FT                   /translation="KSLVAGGVAGGVSRTAVAPLERLKILQQVAGSTTTAYNGVLRGLT
FT                   HIMRTEGMVGMFKGNGANCIRIVPNSASKFLAYETLESWLLSRARESDPNAQLGPLTRL
FT                   TAGAGAGIFAMSATYPLDMVRGRLTTQVDGKYKQYTSMTHAARVIVREEGALALYKGWL
FT                   PSVIGVIPYVGLNFAVYGTLKDVVAEWQGLKSGKDLSVPLGLACGGVAGAIGQTVAYPF
FT                   DVCRRKLQVAGWAGAKALAEGEAKHLAEMRYTGMVDCFVKTVRHEGVGALFHGLSANYV
FT                   KVAPSIAIAFVCYEEVKKLLGV"
     KSLVAGGVAG GVSRTAVAPL ERLKILQQVA GSTTTAYNGV LRGLTHIMRT EGMVGMFKGN        60
     GANCIRIVPN SASKFLAYET LESWLLSRAR ESDPNAQLGP LTRLTAGAGA GIFAMSATYP       120
     LDMVRGRLTT QVDGKYKQYT SMTHAARVIV REEGALALYK GWLPSVIGVI PYVGLNFAVY       180
     GTLKDVVAEW QGLKSGKDLS VPLGLACGGV AGAIGQTVAY PFDVCRRKLQ VAGWAGAKAL       240
     AEGEAKHLAE MRYTGMVDCF VKTVRHEGVG ALFHGLSANY VKVAPSIAIA FVCYEEVKKL       300
     LGV                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page