(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE305

MICSR_1.PE305        Location/Qualifiers
FT   CDS             complement(604839..606470)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636935"
FT                   /orf_name="MICPUN_56882"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62172.1"
FT                   /db_xref="UniParc:UPI000199A6C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I2"
FT                   /transl_table=1
FT                   /translation="MPEKDGSWLLGVVVCSKTGTCLVNACSDAPLRVRELCRMLPALHS
FT                   LAAGVASPTSHLDLSTCSVALCESRVGYIVAALTSPGADWRQRRTSASFVAETVSRAFA
FT                   WHGGEHLESFIARDMDDAVMDATFDAGEDADDGDDDDATTHPQFRSFELEFLRPALARE
FT                   FARPAHVRWLEPLVGCVTARVAHAHVLIPRSRDDDASHGSGHRPATNDDVAAAVRDDRE
FT                   FDDSALSDAVRTKELGARATWECHVVASARGTEASHPLARLCDVDAVGCGEIWRETRER
FT                   CLAMAESRARRCAATAEVGGTFDGDGVGLSGHRRVSSRVKGAGVVRGAFAKREASTPPE
FT                   TAVLVFRNVGGGGGKKDGDVGRDRRTLRAVIHAFSCHPGSAIGTACAVAFCVSPPVGDS
FT                   PGGDSPGGDSPGSPTGRGWPDDLDGWDPPEVSGGYVSRRVAGGTGATSSVMPTDLARAM
FT                   FRVADAVRTTLDPHFDWSNHRSSSDGATEAKKRWGGLDGTGLEEGHTERSGRGDGVPAV
FT                   GKDAGWVVVKGAGPPTGRGVRRVVPA"
     MPEKDGSWLL GVVVCSKTGT CLVNACSDAP LRVRELCRML PALHSLAAGV ASPTSHLDLS        60
     TCSVALCESR VGYIVAALTS PGADWRQRRT SASFVAETVS RAFAWHGGEH LESFIARDMD       120
     DAVMDATFDA GEDADDGDDD DATTHPQFRS FELEFLRPAL AREFARPAHV RWLEPLVGCV       180
     TARVAHAHVL IPRSRDDDAS HGSGHRPATN DDVAAAVRDD REFDDSALSD AVRTKELGAR       240
     ATWECHVVAS ARGTEASHPL ARLCDVDAVG CGEIWRETRE RCLAMAESRA RRCAATAEVG       300
     GTFDGDGVGL SGHRRVSSRV KGAGVVRGAF AKREASTPPE TAVLVFRNVG GGGGKKDGDV       360
     GRDRRTLRAV IHAFSCHPGS AIGTACAVAF CVSPPVGDSP GGDSPGGDSP GSPTGRGWPD       420
     DLDGWDPPEV SGGYVSRRVA GGTGATSSVM PTDLARAMFR VADAVRTTLD PHFDWSNHRS       480
     SSDGATEAKK RWGGLDGTGL EEGHTERSGR GDGVPAVGKD AGWVVVKGAG PPTGRGVRRV       540
     VPA                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page