(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE306

MICSR_1.PE306        Location/Qualifiers
FT   CDS             606648..607781
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636936"
FT                   /orf_name="MICPUN_56883"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61746.1"
FT                   /db_xref="HOGENOM:HBG406789"
FT                   /db_xref="UniParc:UPI000199A6C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I3"
FT                   /transl_table=1
FT                   /translation="MGSGLLAAAPLGIAASAPRSRRRTRRAPVNVAATSASGEDGLERV
FT                   ENCSGCLRPESCPCPKAIRRAKQKQQQRRRETSRRDEDDAAPGRRAVLSALGAVAMGGG
FT                   GAVVPGNPAVAMENGLISEAWSAISGAPSDLTFPEDFLGTWLCYSTLTRVDTLQGDELV
FT                   QDIAVVNRARKDVGQQIVYPMRFIKNDQGRVVMDRAYNVVRMAEATARAYNVIDSVEWD
FT                   VNDPNVLRGRIGADGRSVFFRVNQRSEEYPAPDRIETSEVAQIVFDGGDNGGYAPTPTD
FT                   DSVPAAIPAMALGPDGTRDPSGAAKATKVKSSRTFTKWKFRSAEAAGDGPAIVAGQTVY
FT                   DYLTSFDPGFIESRGQPVTQYTYKLALFRANKYNLEN"
     MGSGLLAAAP LGIAASAPRS RRRTRRAPVN VAATSASGED GLERVENCSG CLRPESCPCP        60
     KAIRRAKQKQ QQRRRETSRR DEDDAAPGRR AVLSALGAVA MGGGGAVVPG NPAVAMENGL       120
     ISEAWSAISG APSDLTFPED FLGTWLCYST LTRVDTLQGD ELVQDIAVVN RARKDVGQQI       180
     VYPMRFIKND QGRVVMDRAY NVVRMAEATA RAYNVIDSVE WDVNDPNVLR GRIGADGRSV       240
     FFRVNQRSEE YPAPDRIETS EVAQIVFDGG DNGGYAPTPT DDSVPAAIPA MALGPDGTRD       300
     PSGAAKATKV KSSRTFTKWK FRSAEAAGDG PAIVAGQTVY DYLTSFDPGF IESRGQPVTQ       360
     YTYKLALFRA NKYNLEN                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page