(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE307

MICSR_1.PE307        Location/Qualifiers
FT   CDS             complement(608056..610962)
FT                   /codon_start=1
FT                   /gene_family="HOG000205991" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636937"
FT                   /orf_name="MICPUN_104770"
FT                   /product="Predicted protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="ACO62173.1"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG284496"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015930"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI000199A6C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I4"
FT                   /transl_table=1
FT                   /translation="MMRKAVNGRALRRLLERAAPATSSTAGSRGFASTARTTGAIAAPL
FT                   ARRAPLASRAPAPPRAGSLLPAASLASIARSARSASTFLAEYDAHVAERAAQNIAPKPL
FT                   DAKQVAALCEQLESPPAGDEAVLMDLFENRVPPGVDEAAYVKASWLAAIVEGKARSPLV
FT                   DAAKAVRILGTMQGGYNIAPLVQALDDPALGPLAADQLTGTLLVFDAFHDVEAKAKAGN
FT                   EHATRVMRSWADAEWFTRRPPVPEKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHAL
FT                   AMLKNPRDGIHDAPAQIEELKTKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPNVP
FT                   NKRTGGVCVGGKIAPIFFNTMEDSGALPLEMDVTNMNMGDVVEIYPYQGVAKRHGSGEE
FT                   LCRFSLKTDVLLDEVQAGGRINLIIGRGLTSRARESLGLPASDVFRLPSNPPGSGSKGF
FT                   TLAQKMVGKACGVDGGILPGTYCEPKMTTVGSQDTTGPMTRDELKDLACLGFSSDLVMQ
FT                   SFCHTAAYPKPVDVVTHHTLPDFIRNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSH
FT                   TRFPIGISFPAGSGLVAFGAATGVIPLDMPESVLVRFKGTMQPGITLRDLVHAIPYYAI
FT                   KEGHLTVAKQGKKNIFSGRILEIEGLSHLKCEQAFELSDASAERSAAGCTIKLDKEPIA
FT                   EYLRSNIIMLKWMIDQGYGDRRTLERRIAGMEAWLADPKLLEADPDAEYAAVIEIDMDQ
FT                   IKEPILCAPNDPDDARLLSEVTGDKVDEVFIGSCMTNIGHFRAAGKLLKEFDGQLPTRL
FT                   WVAPPTKMDEAQLTAEGYYSVYGSVGARTEMPGCSLCMGNQARVAEKSTVVSTSTRNFP
FT                   NRLGKGANVYLASAELAAVSAILGRLPTPAEYLEYAGKLDATASDTYRYLNFDELPQYV
FT                   ESADKVTMEDEAYAGLGPAMREQLLKVAREKKAAKAAA"
     MMRKAVNGRA LRRLLERAAP ATSSTAGSRG FASTARTTGA IAAPLARRAP LASRAPAPPR        60
     AGSLLPAASL ASIARSARSA STFLAEYDAH VAERAAQNIA PKPLDAKQVA ALCEQLESPP       120
     AGDEAVLMDL FENRVPPGVD EAAYVKASWL AAIVEGKARS PLVDAAKAVR ILGTMQGGYN       180
     IAPLVQALDD PALGPLAADQ LTGTLLVFDA FHDVEAKAKA GNEHATRVMR SWADAEWFTR       240
     RPPVPEKITV TVFKVTGETN TDDLSPAPDA WSRPDIPLHA LAMLKNPRDG IHDAPAQIEE       300
     LKTKGFPLAY VGDVVGTGSS RKSATNSVLW FMGDDIPNVP NKRTGGVCVG GKIAPIFFNT       360
     MEDSGALPLE MDVTNMNMGD VVEIYPYQGV AKRHGSGEEL CRFSLKTDVL LDEVQAGGRI       420
     NLIIGRGLTS RARESLGLPA SDVFRLPSNP PGSGSKGFTL AQKMVGKACG VDGGILPGTY       480
     CEPKMTTVGS QDTTGPMTRD ELKDLACLGF SSDLVMQSFC HTAAYPKPVD VVTHHTLPDF       540
     IRNRGGVSLR PGDGVIHSWL NRMLLPDTVG TGGDSHTRFP IGISFPAGSG LVAFGAATGV       600
     IPLDMPESVL VRFKGTMQPG ITLRDLVHAI PYYAIKEGHL TVAKQGKKNI FSGRILEIEG       660
     LSHLKCEQAF ELSDASAERS AAGCTIKLDK EPIAEYLRSN IIMLKWMIDQ GYGDRRTLER       720
     RIAGMEAWLA DPKLLEADPD AEYAAVIEID MDQIKEPILC APNDPDDARL LSEVTGDKVD       780
     EVFIGSCMTN IGHFRAAGKL LKEFDGQLPT RLWVAPPTKM DEAQLTAEGY YSVYGSVGAR       840
     TEMPGCSLCM GNQARVAEKS TVVSTSTRNF PNRLGKGANV YLASAELAAV SAILGRLPTP       900
     AEYLEYAGKL DATASDTYRY LNFDELPQYV ESADKVTMED EAYAGLGPAM REQLLKVARE       960
     KKAAKAAA                                                                968
//

If you have problems or comments...

PBIL Back to PBIL home page