(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE308

MICSR_1.PE308        Location/Qualifiers
FT   CDS             611512..612834
FT                   /codon_start=1
FT                   /gene_family="HOG000264470" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636938"
FT                   /orf_name="MICPUN_56885"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61747.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG560126"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199A6C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I5"
FT                   /transl_table=1
FT                   /translation="MFAVAPILGAGAVGLGRARTLPTSTRISTSPRSTNRVATVVRAAR
FT                   KGSPQSAQGRKKMSKGKIAKKNQEFIEQDTEKDAQIEAMRKAAAASRASVDEGEQASSM
FT                   PPGKLDGMSFEDKLKAVKEEGAAKRQQMAEAEAPRKLMDEMLTGKAPVMRSSIYDDAPA
FT                   KPGGITFAQAGGKTPDDELNVFVKIGAGLLSLGLLVVFIPSDFVFSTNVSSAPQGELSP
FT                   EIVEQVKKQASIYEEALASTPEDVDKLRGAAESYVVLEDYTAAIPLLKRLLEIQPSVEN
FT                   VGNLADVYAANGSLAKAAEVYRDAVNAEWSGASLKPPALVKGLVDALDKDGRYGLSLEY
FT                   VKKFREKGQVDDVDGALLEARVYSGWKGHSKEAEKAYQDVIDTHGDDFRGYLAKGVFYR
FT                   EIGKPDAAEGMFRQAKALVPGEMREVANAVIAQAKAQGALQ"
     MFAVAPILGA GAVGLGRART LPTSTRISTS PRSTNRVATV VRAARKGSPQ SAQGRKKMSK        60
     GKIAKKNQEF IEQDTEKDAQ IEAMRKAAAA SRASVDEGEQ ASSMPPGKLD GMSFEDKLKA       120
     VKEEGAAKRQ QMAEAEAPRK LMDEMLTGKA PVMRSSIYDD APAKPGGITF AQAGGKTPDD       180
     ELNVFVKIGA GLLSLGLLVV FIPSDFVFST NVSSAPQGEL SPEIVEQVKK QASIYEEALA       240
     STPEDVDKLR GAAESYVVLE DYTAAIPLLK RLLEIQPSVE NVGNLADVYA ANGSLAKAAE       300
     VYRDAVNAEW SGASLKPPAL VKGLVDALDK DGRYGLSLEY VKKFREKGQV DDVDGALLEA       360
     RVYSGWKGHS KEAEKAYQDV IDTHGDDFRG YLAKGVFYRE IGKPDAAEGM FRQAKALVPG       420
     EMREVANAVI AQAKAQGALQ                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page