(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE309

MICSR_1.PE309        Location/Qualifiers
FT   CDS             join(612975..613002,613198..613271,613385..613447)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636939"
FT                   /orf_name="MICPUN_56886"
FT                   /product="Predicted protein"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrial respiratory chain "
FT                   /protein_id="ACO61748.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005746"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG560127"
FT                   /db_xref="InterPro:IPR008432"
FT                   /db_xref="UniParc:UPI000199A6CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I6"
FT                   /transl_table=1
FT                   /translation="MGAVQYFGNAAKVYVGTEIAIGLGLGLVAGAVWKNWHWQTRAKEQ
FT                   AYFASIKGK"
     MGAVQYFGNA AKVYVGTEIA IGLGLGLVAG AVWKNWHWQT RAKEQAYFAS IKGK              54
//

If you have problems or comments...

PBIL Back to PBIL home page