(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE31

MICSR_1.PE31         Location/Qualifiers
FT   CDS             56429..57250
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636036"
FT                   /orf_name="MICPUN_107851"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61599.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AB27"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q8"
FT                   /transl_table=1
FT                   /translation="MRGSFADLVAVPSSQLATKPPSLTHAEAAALVLPGLTVVQALRQH
FT                   GFGPGTRVLVLGASGGVGHLAVQVASARGAQLVVGVCSGRNVEFVKSMGADDVLDYEAL
FT                   EPPDDDEAGVAPDPLVEALREVLRKHGGRPFDLVLDTVSSHDARDRAHAYKSRIRSNPA
FT                   LLDDSPNAADKHNYVTIGGRTGGWITAGVKRVTGVNLFKRGKELFWINFNQCAPDLRTL
FT                   RALAEGEGSNGGVRAVKPAIERTVPLTDEGVREAFRALHGRRVRGKLAIEL"
     MRGSFADLVA VPSSQLATKP PSLTHAEAAA LVLPGLTVVQ ALRQHGFGPG TRVLVLGASG        60
     GVGHLAVQVA SARGAQLVVG VCSGRNVEFV KSMGADDVLD YEALEPPDDD EAGVAPDPLV       120
     EALREVLRKH GGRPFDLVLD TVSSHDARDR AHAYKSRIRS NPALLDDSPN AADKHNYVTI       180
     GGRTGGWITA GVKRVTGVNL FKRGKELFWI NFNQCAPDLR TLRALAEGEG SNGGVRAVKP       240
     AIERTVPLTD EGVREAFRAL HGRRVRGKLA IEL                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page